Name : SAR2069 (SAR2069) Accession : YP_041439.1 Strain : Staphylococcus aureus MRSA252 Genome accession: NC_002952 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 2152111 - 2152260 bp Length : 150 bp Strand : - Note : Similar to bacteriophage phi PVL hypothetical protein Orf 57 TR:O80095 (EMBL:AB009866) (54 aa) fasta scores: E(): 3.9e-19, 93.87% id in 49 aa, and to Staphylococcus aureus prophage phiPV83 phi PVL Orf 57 / phi 11 RinB homologue TR:Q9MBQ7 (EMBL:AB044554) ( DNA sequence : ATGATTAAGCAAATACTAAGATTATTATTCTTACTAGCGATGTATGAGTTAGGTAAGTATGTAACTGAGCAAGTATATAT TATGATGACGGCTAATGATGATGTAGAGGCGCCGAGTGATTACGTCTTTCGAGCGGAGGTAAGTGAGTGA Protein sequence : MIKQILRLLFLLAMYELGKYVTEQVYIMMTANDDVEAPSDYVFRAEVSE |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
SAUSA300_1946 | YP_494597.1 | phiPVL ORF057-like protein, transcriptional activator RinB | Not tested | ¥ÕSa3 | Protein | 3e-17 | 100 |
SAKOR_01951 | YP_008492139.1 | Transcriptional activator rinB | Not tested | ¥ÕSa3 | Protein | 3e-17 | 100 |
MW1916 | NP_646733.1 | hypothetical protein | Not tested | ¥ÕSa3 | Protein | 3e-17 | 100 |
SAS062 | NP_375080.1 | hypothetical protein | Not tested | ¥ÕSa3 | Protein | 3e-17 | 100 |
SAUSA300_1946 | YP_494597.1 | phiPVL ORF057-like protein, transcriptional activator RinB | Not tested | ¥ÕSa3 | Protein | 3e-17 | 100 |
SAOV_1096 | YP_005736591.1 | Transcriptional activator, phage associated | Not tested | ¥ÕSa2 | Protein | 8e-17 | 98 |
SAOV_1937c | YP_005737381.1 | transcriptional activator rinB | Not tested | ¥ÕSa3 | Protein | 8e-17 | 98 |
SAV1971 | NP_372495.2 | hypothetical protein | Not tested | ¥ÕSa3 | Protein | 9e-12 | 95 |
SAUSA300_1412 | YP_494109.1 | phiSLT ORF 50-like protein | Not tested | ¥ÕSa2 | Protein | 3e-14 | 94 |
SAV0882 | NP_371406.1 | int gene activator RinB | Not tested | ¥ÕSa1 | Protein | 8e-13 | 91 |
SAOV_0310 | YP_005735827.1 | transcriptional activator rinB | Not tested | ¥ÕSa1 | Protein | 2e-13 | 90 |
MW1411 | NP_646228.1 | hypothetical protein | Not tested | ¥ÕSa2 | Protein | 2e-13 | 88 |