Gene Information

Name : SAR2069 (SAR2069)
Accession : YP_041439.1
Strain : Staphylococcus aureus MRSA252
Genome accession: NC_002952
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2152111 - 2152260 bp
Length : 150 bp
Strand : -
Note : Similar to bacteriophage phi PVL hypothetical protein Orf 57 TR:O80095 (EMBL:AB009866) (54 aa) fasta scores: E(): 3.9e-19, 93.87% id in 49 aa, and to Staphylococcus aureus prophage phiPV83 phi PVL Orf 57 / phi 11 RinB homologue TR:Q9MBQ7 (EMBL:AB044554) (

DNA sequence : 
ATGATTAAGCAAATACTAAGATTATTATTCTTACTAGCGATGTATGAGTTAGGTAAGTATGTAACTGAGCAAGTATATAT
TATGATGACGGCTAATGATGATGTAGAGGCGCCGAGTGATTACGTCTTTCGAGCGGAGGTAAGTGAGTGA

Protein sequence : 
MIKQILRLLFLLAMYELGKYVTEQVYIMMTANDDVEAPSDYVFRAEVSE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
MW1916 NP_646733.1 hypothetical protein Not tested ¥ÕSa3 Protein 3e-17 100
SAS062 NP_375080.1 hypothetical protein Not tested ¥ÕSa3 Protein 3e-17 100
SAUSA300_1946 YP_494597.1 phiPVL ORF057-like protein, transcriptional activator RinB Not tested ¥ÕSa3 Protein 3e-17 100
SAUSA300_1946 YP_494597.1 phiPVL ORF057-like protein, transcriptional activator RinB Not tested ¥ÕSa3 Protein 3e-17 100
SAKOR_01951 YP_008492139.1 Transcriptional activator rinB Not tested ¥ÕSa3 Protein 3e-17 100
SAOV_1096 YP_005736591.1 Transcriptional activator, phage associated Not tested ¥ÕSa2 Protein 8e-17 98
SAOV_1937c YP_005737381.1 transcriptional activator rinB Not tested ¥ÕSa3 Protein 8e-17 98
SAV1971 NP_372495.2 hypothetical protein Not tested ¥ÕSa3 Protein 9e-12 95
SAUSA300_1412 YP_494109.1 phiSLT ORF 50-like protein Not tested ¥ÕSa2 Protein 3e-14 94
SAV0882 NP_371406.1 int gene activator RinB Not tested ¥ÕSa1 Protein 8e-13 91
SAOV_0310 YP_005735827.1 transcriptional activator rinB Not tested ¥ÕSa1 Protein 2e-13 90
MW1411 NP_646228.1 hypothetical protein Not tested ¥ÕSa2 Protein 2e-13 88