
| Name : arsR2 (SAR1855) Accession : YP_041241.1 Strain : Staphylococcus aureus MRSA252 Genome accession: NC_002952 Putative virulence/resistance : Resistance Product : arsenical resistance operon repressor 2 Function : - COG functional category : K : Transcription COG ID : COG0640 EC number : - Position : 1946186 - 1946500 bp Length : 315 bp Strand : + Note : Similar to Staphylococcus aureus arsenical resistance operon repressor ArsR SW:ARSR_STAAU (P30338) (104 aa) fasta scores: E(): 5.4e-32, 75.962% id in 104 aa, and to Bacillus subtilis arsenical resistance operon repressor ArsR SW:ARSR_BACSU (P45949) (105 a DNA sequence : ATGACGTATAAAGAACTAGCAACATATTTAAAAATTTTATCAGATTCAAGCAGATTAGAAATACTAGATTTACTTTCTTG TGGAGAGTTATGCGCTTGTGATTTGTTAGAACATTTTCAATTCTCTCAACCCACACTTAGCTATCATATGAAAGCATTAG TAAAAACCAACTTAGTTACGACACGAAAAATCGGAAATAAACATTTATACCAGCTTAATCATAATATTTTTGAGTCCGTA ATTAATAACTTGTCAAAAGTTCATACCTCTAACCAACGATGTATTTGTCATAACCTTAAGACTGGTGAATGCTAA Protein sequence : MTYKELATYLKILSDSSRLEILDLLSCGELCACDLLEHFQFSQPTLSYHMKALVKTNLVTTRKIGNKHLYQLNHNIFESV INNLSKVHTSNQRCICHNLKTGEC | 
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity | 
| arsR | YP_005754066.1 | arsenical resistance operon repressor | Not tested | Type-XI SCCmec | Protein | 2e-32 | 70 | 
| arsR | YP_252018.1 | arsenical resistance operon repressor | Not tested | SCCmec | Protein | 1e-29 | 65 | 
| arsR | YP_252025.1 | arsenical resistance operon repressor | Not tested | SCCmec | Protein | 4e-30 | 62 | 
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity | 
| arsR2 | YP_041241.1 | arsenical resistance operon repressor 2 | BAC0590 | Protein | 3e-36 | 76 | 
| arsR2 | YP_041241.1 | arsenical resistance operon repressor 2 | BAC0592 | Protein | 2e-33 | 72 | 
 
 
  