Gene Information

Name : arsR2 (SAR1855)
Accession : YP_041241.1
Strain : Staphylococcus aureus MRSA252
Genome accession: NC_002952
Putative virulence/resistance : Resistance
Product : arsenical resistance operon repressor 2
Function : -
COG functional category : K : Transcription
COG ID : COG0640
EC number : -
Position : 1946186 - 1946500 bp
Length : 315 bp
Strand : +
Note : Similar to Staphylococcus aureus arsenical resistance operon repressor ArsR SW:ARSR_STAAU (P30338) (104 aa) fasta scores: E(): 5.4e-32, 75.962% id in 104 aa, and to Bacillus subtilis arsenical resistance operon repressor ArsR SW:ARSR_BACSU (P45949) (105 a

DNA sequence : 
ATGACGTATAAAGAACTAGCAACATATTTAAAAATTTTATCAGATTCAAGCAGATTAGAAATACTAGATTTACTTTCTTG
TGGAGAGTTATGCGCTTGTGATTTGTTAGAACATTTTCAATTCTCTCAACCCACACTTAGCTATCATATGAAAGCATTAG
TAAAAACCAACTTAGTTACGACACGAAAAATCGGAAATAAACATTTATACCAGCTTAATCATAATATTTTTGAGTCCGTA
ATTAATAACTTGTCAAAAGTTCATACCTCTAACCAACGATGTATTTGTCATAACCTTAAGACTGGTGAATGCTAA

Protein sequence : 
MTYKELATYLKILSDSSRLEILDLLSCGELCACDLLEHFQFSQPTLSYHMKALVKTNLVTTRKIGNKHLYQLNHNIFESV
INNLSKVHTSNQRCICHNLKTGEC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsR YP_005754066.1 arsenical resistance operon repressor Not tested Type-XI SCCmec Protein 2e-32 70
arsR YP_252018.1 arsenical resistance operon repressor Not tested SCCmec Protein 1e-29 65
arsR YP_252025.1 arsenical resistance operon repressor Not tested SCCmec Protein 4e-30 62

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
arsR2 YP_041241.1 arsenical resistance operon repressor 2 BAC0590 Protein 3e-36 76
arsR2 YP_041241.1 arsenical resistance operon repressor 2 BAC0592 Protein 2e-33 72