Name : rpmG (SAR1628) Accession : YP_041024.1 Strain : Staphylococcus aureus MRSA252 Genome accession: NC_002952 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L33 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0267 EC number : - Position : 1696332 - 1696481 bp Length : 150 bp Strand : - Note : in Escherichia coli BM108, a mutation that results in lack of L33 synthesis had no effect on ribosome synthesis or function; there are paralogous genes in several bacterial genomes, and a CXXC motif for zinc binding and an upstream regulation region of th DNA sequence : ATGCGCGTAAACGTAACTTTAGCTTGTACGGAATGTGGTGACAGAAACTACATTACAACTAAGAACAAAAGAAATAATCC AGAACGTGTTGAAATGAAGAAATTCTGTTCACGTGAAAACAAACAAACTTTACACCGTGAAACAAAATAA Protein sequence : MRVNVTLACTECGDRNYITTKNKRNNPERVEMKKFCSRENKQTLHRETK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
rpmG | NP_814353.1 | 50S ribosomal protein L33 | Not tested | Not named | Protein | 1e-08 | 49 |
ef0106 | AAM75309.1 | EF0106 | Not tested | Not named | Protein | 9e-09 | 49 |