
|
Name : SAR1546 (SAR1546) Accession : YP_040948.1 Strain : Staphylococcus aureus MRSA252 Genome accession: NC_002952 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 1630262 - 1630423 bp Length : 162 bp Strand : - Note : Similar to Staphylococcus aureus temperate phage phiSLT phi PVL Orf 38 homologue TR:Q9B0G7 (EMBL:AB045978) (53 aa) fasta scores: E(): 3.3e-20, 96.226% id in 53 aa, and to bacteriophage phi PVL hypothetical protein Orf 38 TR:O80077 (EMBL:AB009866) (53 aa) DNA sequence : ATGAGCGACACATATAAAAGCTACCTAATAGCAGTGCTATGCTTCACGGTCTTAGCGATTGTACTCATGCCGTTTCTATA CTTCACTACAGCGTGGTCCATTGCAGGATTCGCAAGTATCGCAACATTCATATTCTATAAAGAGTACTTTTATGAAGAAT AA Protein sequence : MSDTYKSYLIAVLCFTVLAIVLMPFLYFTTAWSIAGFASIATFIFYKEYFYEE |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SAOV_1078 | YP_005736573.1 | hypothetical protein | Not tested | ¥ÕSa2 | Protein | 2e-17 | 99 |
| MW1430 | NP_646247.1 | hypothetical protein | Not tested | ¥ÕSa2 | Protein | 7e-18 | 97 |
| SAKOR_01970 | YP_008492158.1 | Phage protein | Not tested | ¥ÕSa3 | Protein | 7e-18 | 97 |
| SAS063 | NP_375098.1 | hypothetical protein | Not tested | ¥ÕSa3 | Protein | 7e-18 | 97 |
| MW1927 | NP_646744.1 | hypothetical protein | Not tested | ¥ÕSa3 | Protein | 8e-18 | 95 |
| SAV1990 | NP_372514.1 | phi PVL ORF 38-like protein | Not tested | ¥ÕSa3 | Protein | 8e-16 | 84 |