|
Name : SAR1527 (SAR1527) Accession : YP_040929.1 Strain : Staphylococcus aureus MRSA252 Genome accession: NC_002952 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 1621736 - 1621888 bp Length : 153 bp Strand : - Note : Similar to Staphylococcus aureus temperate phage phiSLT phi PVL Orf 57 homologue TR:Q9B0E9 (EMBL:AB045978) (51 aa) fasta scores: E(): 2.2e-20, 98.039% id in 51 aa, and to bacteriophage phi ETA hypothetical protein Orf37 TR:Q9G008 (EMBL:AP001553) (57 aa) f DNA sequence : ATGATTAAACAAATATTAAGACTAATATTCTTACTAGCAATGTATGAGCTAGGTAAGTATGTAACGGAGCAAGTATATAT TATGATGACGGCTAATGATGATGTAGAGGTGCCGAGTGATTTTGAAAAAATCAGAGCTGAAGTTTCATGGTAA Protein sequence : MIKQILRLIFLLAMYELGKYVTEQVYIMMTANDDVEVPSDFEKIRAEVSW |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SAOV_0310 | YP_005735827.1 | transcriptional activator rinB | Not tested | ¥ÕSa1 | Protein | 6e-17 | 94 |
| SAUSA300_1412 | YP_494109.1 | phiSLT ORF 50-like protein | Not tested | ¥ÕSa2 | Protein | 4e-17 | 94 |
| MW1916 | NP_646733.1 | hypothetical protein | Not tested | ¥ÕSa3 | Protein | 2e-13 | 88 |
| SAS062 | NP_375080.1 | hypothetical protein | Not tested | ¥ÕSa3 | Protein | 2e-13 | 88 |
| SAUSA300_1946 | YP_494597.1 | phiPVL ORF057-like protein, transcriptional activator RinB | Not tested | ¥ÕSa3 | Protein | 2e-13 | 88 |
| SAUSA300_1946 | YP_494597.1 | phiPVL ORF057-like protein, transcriptional activator RinB | Not tested | ¥ÕSa3 | Protein | 2e-13 | 88 |
| SAKOR_01951 | YP_008492139.1 | Transcriptional activator rinB | Not tested | ¥ÕSa3 | Protein | 2e-13 | 88 |
| MW1411 | NP_646228.1 | hypothetical protein | Not tested | ¥ÕSa2 | Protein | 2e-16 | 88 |
| SAOV_1096 | YP_005736591.1 | Transcriptional activator, phage associated | Not tested | ¥ÕSa2 | Protein | 4e-13 | 86 |
| SAOV_1937c | YP_005737381.1 | transcriptional activator rinB | Not tested | ¥ÕSa3 | Protein | 4e-13 | 86 |
| SAV1971 | NP_372495.2 | hypothetical protein | Not tested | ¥ÕSa3 | Protein | 5e-11 | 83 |
| SAV0882 | NP_371406.1 | int gene activator RinB | Not tested | ¥ÕSa1 | Protein | 1e-13 | 81 |
