Gene Information

Name : SAR1527 (SAR1527)
Accession : YP_040929.1
Strain : Staphylococcus aureus MRSA252
Genome accession: NC_002952
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1621736 - 1621888 bp
Length : 153 bp
Strand : -
Note : Similar to Staphylococcus aureus temperate phage phiSLT phi PVL Orf 57 homologue TR:Q9B0E9 (EMBL:AB045978) (51 aa) fasta scores: E(): 2.2e-20, 98.039% id in 51 aa, and to bacteriophage phi ETA hypothetical protein Orf37 TR:Q9G008 (EMBL:AP001553) (57 aa) f

DNA sequence :
ATGATTAAACAAATATTAAGACTAATATTCTTACTAGCAATGTATGAGCTAGGTAAGTATGTAACGGAGCAAGTATATAT
TATGATGACGGCTAATGATGATGTAGAGGTGCCGAGTGATTTTGAAAAAATCAGAGCTGAAGTTTCATGGTAA

Protein sequence :
MIKQILRLIFLLAMYELGKYVTEQVYIMMTANDDVEVPSDFEKIRAEVSW

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAOV_0310 YP_005735827.1 transcriptional activator rinB Not tested ¥ÕSa1 Protein 6e-17 94
SAUSA300_1412 YP_494109.1 phiSLT ORF 50-like protein Not tested ¥ÕSa2 Protein 4e-17 94
SAS062 NP_375080.1 hypothetical protein Not tested ¥ÕSa3 Protein 2e-13 88
SAUSA300_1946 YP_494597.1 phiPVL ORF057-like protein, transcriptional activator RinB Not tested ¥ÕSa3 Protein 2e-13 88
SAUSA300_1946 YP_494597.1 phiPVL ORF057-like protein, transcriptional activator RinB Not tested ¥ÕSa3 Protein 2e-13 88
SAKOR_01951 YP_008492139.1 Transcriptional activator rinB Not tested ¥ÕSa3 Protein 2e-13 88
MW1916 NP_646733.1 hypothetical protein Not tested ¥ÕSa3 Protein 2e-13 88
MW1411 NP_646228.1 hypothetical protein Not tested ¥ÕSa2 Protein 2e-16 88
SAOV_1096 YP_005736591.1 Transcriptional activator, phage associated Not tested ¥ÕSa2 Protein 4e-13 86
SAOV_1937c YP_005737381.1 transcriptional activator rinB Not tested ¥ÕSa3 Protein 4e-13 86
SAV1971 NP_372495.2 hypothetical protein Not tested ¥ÕSa3 Protein 5e-11 83
SAV0882 NP_371406.1 int gene activator RinB Not tested ¥ÕSa1 Protein 1e-13 81