
|
Name : SAR1304 (SAR1304) Accession : YP_040713.1 Strain : Staphylococcus aureus MRSA252 Genome accession: NC_002952 Putative virulence/resistance : Unknown Product : DNA-binding protein Function : - COG functional category : - COG ID : - EC number : - Position : 1367017 - 1367202 bp Length : 186 bp Strand : + Note : Similar to Escherichia coli O157:H7 DNA transposition protein ECS4946 TR:BAB38369 (EMBL:AP002567) (310 aa) fasta scores: E(): 0.64, 36.066% id in 61 aa, and to bacteriophage APSE-1 hypothetical protein p2 SW:VP02_BPAPS (Q9T1U6) (94 aa) fasta scores: E(): DNA sequence : ATGTCAGAATACAAGAAAAAGATAATTGAATTAATTGAAAGTAATTTAACAGGATATGAAATTTCTAAAAAAACTGGAGT TTCTCAATATGTACTTTCACAATTAAGACAGGGCAAACGCGAAGTAGATAATCTAACCCTGAATACAACAGAAAAATTAT ATGAATATGCCAATAAAGTTTTGTAA Protein sequence : MSEYKKKIIELIESNLTGYEISKKTGVSQYVLSQLRQGKREVDNLTLNTTEKLYEYANKVL |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SACOL0911 | YP_185782.1 | hypothetical protein | Not tested | vSa1 | Protein | 1e-17 | 79 |
| SACOL1175 | YP_186038.1 | hypothetical protein | Not tested | vSa¥ã | Protein | 0.023 | 41 |
| MW1046 | NP_645863.1 | hypothetical protein | Not tested | vSa¥ã | Protein | 0.023 | 41 |
| SAV1164 | NP_371688.1 | hypothetical protein | Not tested | vSa¥ã | Protein | 0.023 | 41 |
| SA1008 | NP_374280.1 | hypothetical protein | Not tested | vSa¥ã | Protein | 0.023 | 41 |
| SAKOR_01086 | YP_008491274.1 | Hypothetical protein | Not tested | vSa¥ã | Protein | 0.023 | 41 |