
|
Name : SAR1303 (SAR1303) Accession : YP_040712.1 Strain : Staphylococcus aureus MRSA252 Genome accession: NC_002952 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 1365606 - 1365812 bp Length : 207 bp Strand : + Note : Similar to the N-terminal regions of Streptococcus thermophilus bacteriophage Sfi21 hypothetical protein Orf140b protein TR:O21989 (EMBL:X95646) (140 aa) fasta scores: E(): 1.3, 29.310% id in 58 aa, and to bacteriophage PM2 hypothetical protein TR:Q9XJS6 DNA sequence : ATGAATGAGATTGAAACTATTATAAGTGAAATAGAAAAGTTATTAACTAACAATACACCATATAGTATTTCAAAAAACTC AGGTGTACCACGTCAAACAGTTACTGATTTAAAGGTAGGTAATACTAAAATAAAGGATGCCAAATTTAAAACAATAATCA AGTTATATGAGTATCAAAAGTCGTCAGAAAATAATTCAGAGTGCTAA Protein sequence : MNEIETIISEIEKLLTNNTPYSISKNSGVPRQTVTDLKVGNTKIKDAKFKTIIKLYEYQKSSENNSEC |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| MW1046 | NP_645863.1 | hypothetical protein | Not tested | vSa¥ã | Protein | 5e-12 | 56 |
| SAV1164 | NP_371688.1 | hypothetical protein | Not tested | vSa¥ã | Protein | 5e-12 | 56 |
| SA1008 | NP_374280.1 | hypothetical protein | Not tested | vSa¥ã | Protein | 5e-12 | 56 |
| SAKOR_01086 | YP_008491274.1 | Hypothetical protein | Not tested | vSa¥ã | Protein | 5e-12 | 56 |
| SACOL1175 | YP_186038.1 | hypothetical protein | Not tested | vSa¥ã | Protein | 5e-12 | 56 |