
|
Name : SAR1285 (SAR1285) Accession : YP_040697.1 Strain : Staphylococcus aureus MRSA252 Genome accession: NC_002952 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 1350840 - 1351037 bp Length : 198 bp Strand : + Note : Similar to the N-terminal region of Streptococcus thermophilus temperate bacteriophage phi O1205 hypothetical protein Orf57 TR:O34088 (EMBL:U88974) (140 aa) fasta scores: E(): 3.4, 37.500% id in 48 aa. Probable gene remnant. Similar to SAR1302, 51.562% id DNA sequence : ATGAATTGCTATGATGAAATATACAATACAATCAAAAAATTGATAGAAAACAAAGAGATAACGAGTTATCAAATTAATAA AGATACTGGGATAAGTTACGGTAATATTAATGCTATGCGCCGTGGAGAAAGAAGAATAGAAAATTTAAGCTTAAAGAATG CAAAGATCTTATATGAATATGCGAAAAAGGTATTATAA Protein sequence : MNCYDEIYNTIKKLIENKEITSYQINKDTGISYGNINAMRRGERRIENLSLKNAKILYEYAKKVL |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SACOL0911 | YP_185782.1 | hypothetical protein | Not tested | vSa1 | Protein | 3e-06 | 43 |
| SAV1174 | NP_371698.1 | hypothetical protein | Not tested | vSa¥ã | Protein | 2e-07 | 42 |
| SA1017 | NP_374290.1 | hypothetical protein | Virulence | vSa¥ã | Protein | 2e-07 | 42 |
| SAKOR_01096 | YP_008491284.1 | Hypothetical protein | Not tested | vSa¥ã | Protein | 7e-08 | 42 |
| SACOL1185 | YP_186048.1 | hypothetical protein | Not tested | vSa¥ã | Protein | 7e-08 | 42 |
| MW1055 | NP_645872.1 | hypothetical protein | Not tested | vSa¥ã | Protein | 7e-08 | 42 |