Gene Information

Name : SACOL0483 (SACOL0483)
Accession : YP_185373.1
Strain : Staphylococcus aureus COL
Genome accession: NC_002951
Putative virulence/resistance : Virulence
Product : staphyloccoccus tandem lipoprotein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 484842 - 485618 bp
Length : 777 bp
Strand : +
Note : identified by match to protein family HMM PF04507; match to protein family HMM TIGR01742

DNA sequence :
ATGAAGTGTTTTCAGAAATTATACATATTTATATTAATTTTAATCGTATTAATGGCAGGATGCGAAAGTAATAAGATCAC
TGGAGATTCGAAAGAAACACAGATCAAAAAGAGCTTTGCGAAAACATTAGATGTATACCCTACGAAAAATCTAGAAGATT
TTTATGACAAAGAAGGATATCGAGATGGCGAATTTAAAAAGGGTGACAAAGGGAAGTGGGTTATTAGATCTGAAATGACA
ACAGAACTGAAAAATGAAAATATGGTATCTAAAGGTATGGTCATACGTTTAAATAGAAATAGTAGAACATGCACTGGTGA
ATATTTTGTCAGGATAGTTAAAGAAGACAGTGAGGGCAAGGTATATAGTGATGAACGAAAATATCCAGTGAAAATGGAAA
ATAATAAAATCATTACATTAAAACCAATCGATGATGAAAAAGTAAAAAAAGAAATTGAAGAATTTAAATTCTTCGTACAA
TACGGGAATTTCAAAGAATTGGAAAACTATAAAGACGGAGAAGTGACATATAACCCAGAAGCACCAATATACTCTGCACA
ATATCAATTGAAAAATAGTGATTATAATGTAGAACAACTACGTAAGCGATATAATATAACGACGAAAAAAGCGCCTAAAT
TATTATTGAAGGGTTCAGGTAATTTAAAAGGCTCATCAGTTGGATATAAAAATATTGAATTTACCTTTGTTGAAAATAAG
GAAGAAAATATTTACTTCACAGATAGTATTAATTTCAACCCAAGTGAGGATAAATAA

Protein sequence :
MKCFQKLYIFILILIVLMAGCESNKITGDSKETQIKKSFAKTLDVYPTKNLEDFYDKEGYRDGEFKKGDKGKWVIRSEMT
TELKNENMVSKGMVIRLNRNSRTCTGEYFVRIVKEDSEGKVYSDERKYPVKMENNKIITLKPIDDEKVKKEIEEFKFFVQ
YGNFKELENYKDGEVTYNPEAPIYSAQYQLKNSDYNVEQLRKRYNITTKKAPKLLLKGSGNLKGSSVGYKNIEFTFVENK
EENIYFTDSINFNPSEDK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAUSA300_0416 YP_493129.1 tandem lipoprotein Not tested vSa¥á Protein 4e-97 100
SACOL0483 YP_185373.1 staphyloccoccus tandem lipoprotein Not tested vSa¥á Protein 4e-97 100
lpl6nm YP_001331443.1 tandem lipoprotein Not tested vSa¥á Protein 4e-97 100
SAMSHR1132_03920 YP_005324913.1 putative lipoprotein Not tested vSa¥á Protein 2e-79 90
SAS0402 YP_042528.1 lipoprotein Not tested vSa¥á Protein 6e-84 88
lpl13 NP_645217.1 hypothetical protein Not tested vSa¥á Protein 6e-84 88
SAR0444 YP_039893.1 lipoprotein Not tested vSa¥á Protein 2e-69 81
lpl8 NP_370968.1 hypothetical protein Not tested vSa¥á Protein 4e-68 80
lpl8 NP_373655.1 hypothetical protein Not tested vSa¥á Protein 4e-68 80
SACOL0485 YP_185375.1 hypothetical protein Not tested vSa¥á Protein 7e-68 78
lpl8nm YP_001331445.1 tandem lipoprotein Not tested vSa¥á Protein 7e-68 78
SAUSA300_0418 YP_493131.1 tandem lipoprotein Not tested vSa¥á Protein 7e-68 78
lpl3 NP_370962.1 hypothetical protein Not tested vSa¥á Protein 2e-58 67
lpl3 NP_373649.1 hypothetical protein Virulence vSa¥á Protein 2e-58 67
SAMSHR1132_03880 YP_005324909.1 putative lipoprotein Not tested vSa¥á Protein 4e-57 65
SAMSHR1132_03850 YP_005324906.1 putative lipoprotein Not tested vSa¥á Protein 8e-59 65
unnamed AAL26686.1 unknown Not tested SCCcap1 Protein 6e-58 63
SAKOR_00421 YP_008490605.1 Membrane lipoprotein Not tested vSa¥á Protein 4e-50 63
SAMSHR1132_03910 YP_005324912.1 putative lipoprotein Not tested vSa¥á Protein 3e-53 62
SACOL0482 YP_185372.1 hypothetical protein Not tested vSa¥á Protein 1e-51 62
lpl5nm YP_001331442.1 tandem lipoprotein Not tested vSa¥á Protein 1e-51 62
lpl3 YP_493128.1 tandem lipoprotein Not tested vSa¥á Protein 2e-51 61
lpl5 NP_370965.1 hypothetical protein Not tested vSa¥á Protein 2e-49 58
lpl5 NP_373652.1 hypothetical protein Not tested vSa¥á Protein 2e-49 58
SAMSHR1132_03900 YP_005324911.1 putative lipoprotein Not tested vSa¥á Protein 3e-47 54
SAR0438 YP_039889.1 lipoprotein Not tested vSa¥á Protein 1e-46 54
lpl14 NP_645218.1 hypothetical protein Not tested vSa¥á Protein 4e-40 54
SAR0445 YP_039894.1 lipoprotein Not tested vSa¥á Protein 2e-50 54
SAKOR_00424 YP_008490608.1 Membrane lipoprotein Not tested vSa¥á Protein 8e-44 54
SAUSA300_0414 YP_493127.1 tandem lipoprotein Not tested vSa¥á Protein 9e-43 52
SAR0442 YP_039891.1 hypothetical protein Not tested vSa¥á Protein 6e-43 52
SAS0400 YP_042526.1 hypothetical protein Not tested vSa¥á Protein 1e-41 52
lpl11 NP_645215.1 hypothetical protein Not tested vSa¥á Protein 1e-41 52
lpl2 NP_370961.1 hypothetical protein Not tested vSa¥á Protein 5e-44 52
lpl2 NP_373648.1 hypothetical protein Virulence vSa¥á Protein 5e-44 52
SACOL0481 YP_185371.1 hypothetical protein Not tested vSa¥á Protein 2e-41 52
SAS0403 YP_042529.1 lipoprotein Not tested vSa¥á Protein 4e-44 52
SAKOR_00420 YP_008490604.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-44 52
lpl4nm YP_001331441.1 tandem lipoprotein Not tested vSa¥á Protein 1e-41 51
SAR0443 YP_039892.1 lipoprotein Not tested vSa¥á Protein 1e-43 51
SAS0401 YP_042527.1 lipoprotein Not tested vSa¥á Protein 1e-46 51
lpl12 NP_645216.1 hypothetical protein Not tested vSa¥á Protein 1e-46 51
lpl6 NP_370966.1 hypothetical protein Not tested vSa¥á Protein 9e-46 51
lpl6 NP_373653.1 hypothetical protein Not tested vSa¥á Protein 9e-46 51
lpl4 NP_373651.1 hypothetical protein Not tested vSa¥á Protein 8e-45 51
SAV0440 NP_370964.1 hypothetical protein Not tested vSa¥á Protein 1e-44 51
lpl9nm YP_001331446.1 tandem lipoprotein Not tested vSa¥á Protein 2e-42 51
SAUSA300_0419 YP_493132.1 tandem lipoprotein Not tested vSa¥á Protein 2e-42 51
SACOL0486 YP_185376.1 hypothetical protein Not tested vSa¥á Protein 2e-42 51
SAS0399 YP_042525.1 lipoprotein Not tested vSa¥á Protein 2e-45 51
lpl10 NP_645214.1 hypothetical protein Not tested vSa¥á Protein 2e-45 51
SAMSHR1132_03840 YP_005324905.1 putative lipoprotein Not tested vSa¥á Protein 9e-44 51
lpl7 NP_370967.1 hypothetical protein Not tested vSa¥á Protein 5e-44 50
SAUSA300_0411 YP_493125.1 tandem lipoprotein Not tested vSa¥á Protein 3e-43 50
lpl7 NP_373654.1 hypothetical protein Not tested vSa¥á Protein 5e-44 50
SAKOR_00425 YP_008490609.1 Membrane lipoprotein Not tested vSa¥á Protein 5e-44 50
SAMSHR1132_03870 YP_005324908.1 putative lipoprotein Not tested vSa¥á Protein 4e-44 50
SAMSHR1132_03940 YP_005324915.1 putative lipoprotein Not tested vSa¥á Protein 1e-42 50
SAMSHR1132_03890 YP_005324910.1 putative lipoprotein Not tested vSa¥á Protein 1e-42 50
SAR0439 YP_039890.1 lipoprotein Not tested vSa¥á Protein 9e-42 49
lpl2nm YP_001331438.1 tandem lipoprotein Not tested vSa¥á Protein 1e-42 49
SAMSHR1132_03930 YP_005324914.1 hypothetical protein Not tested vSa¥á Protein 2e-42 49
lpl1nm YP_001331437.1 tandem lipoprotein Not tested vSa¥á Protein 1e-41 49
SAUSA300_0410 YP_493124.1 tandem lipoprotein Not tested vSa¥á Protein 9e-41 49
SAUSA300_0413 YP_493126.1 tandem lipoprotein Not tested vSa¥á Protein 7e-40 49
lpl3nm YP_001331440.1 tandem lipoprotein Not tested vSa¥á Protein 5e-40 49
SAUSA300_0417 YP_493130.1 tandem lipoprotein Not tested vSa¥á Protein 3e-42 49
SACOL0484 YP_185374.1 hypothetical protein Not tested vSa¥á Protein 3e-42 49
lpl7nm YP_001331444.1 tandem lipoprotein Not tested vSa¥á Protein 3e-42 49
SAKOR_00423 YP_008490607.1 Membrane lipoprotein Not tested vSa¥á Protein 8e-39 48
lpl9 NP_370969.1 hypothetical protein Not tested vSa¥á Protein 3e-39 48
lpl9 NP_373656.1 hypothetical protein Not tested vSa¥á Protein 3e-39 48
SAKOR_00422 YP_008490606.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-42 48
SAMSHR1132_03860 YP_005324907.1 putative lipoprotein Not tested vSa¥á Protein 6e-41 48
SAKOR_00428 YP_008490612.1 Membrane lipoprotein Not tested vSa¥á Protein 4e-39 48
lpl1 NP_370960.1 hypothetical protein Not tested vSa¥á Protein 4e-37 48
lpl1 NP_373647.1 hypothetical protein Virulence vSa¥á Protein 4e-37 48