Gene Information

Name : SACOL0481 (SACOL0481)
Accession : YP_185371.1
Strain : Staphylococcus aureus COL
Genome accession: NC_002951
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 483149 - 483949 bp
Length : 801 bp
Strand : +
Note : identified by match to protein family HMM PF04507; match to protein family HMM TIGR01742

DNA sequence :
ATGAAGTATAAAACAGAGAGACGTGAAGCGATGGGATATTTAAAAAGGTTTGCATTGTACATAAGCGTTATGATTTTAAT
ATTTGCGATAGCAGGTTGTGGCAAAGGTAATGAAACAAAAGAAGATTCAAAGGAAGAACAAATCAAAAAGAGCTTTGCGA
AAACGTTAGATATGTATCCAATTAAGAATCTCGAGGACTTATATGATAAAGAAGGATACCGTGATGGCGAATTTAAAAAG
GGCGACAAAGGAATGTGGACTATATATACAGATTTTGCTAAAGGCAATAAATCAGACGAATTGGATGATGAAGGTATGGT
TTTAAATCTGGATAGAAATACTCGAACGGCTAAGGGATATTATTTTGTTAAGAAATTTTATGAAAAGGATAAATTACCTG
ATAGAAAAAATTATAAAGTTGAAATGAAAAATAATAAAATTATCTTATTAGACAAGGTAGAAGATCCAAATCTAAAAAAG
AGAATAGAAAACTTTAAATTTTTCGGACAATATGCAAATTTTAAGGATTTGGAAAATTACAACAATGGCGACGTGTCAAT
AAATTGGAATGTTCCAAGTTATGACGTGGAATATAAAATGAGCAATAAAGATGAAAATGTTAAACAATTAAGAAGTCGTT
ATAACATTCCTACTGATAAAGCTCCAATGTTAAAAATGCATATTGACGGGGACTTAAAAGGTAGTTCTGTTGGATATAAA
AGGTTAGAAATAGATTTTTCAAAAGAAGGTAGGGATATTTCAGTCATTGATTATTTAAGTTATAAGCCAGCGAAAAAATA
G

Protein sequence :
MKYKTERREAMGYLKRFALYISVMILIFAIAGCGKGNETKEDSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKK
GDKGMWTIYTDFAKGNKSDELDDEGMVLNLDRNTRTAKGYYFVKKFYEKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKK
RIENFKFFGQYANFKDLENYNNGDVSINWNVPSYDVEYKMSNKDENVKQLRSRYNIPTDKAPMLKMHIDGDLKGSSVGYK
RLEIDFSKEGRDISVIDYLSYKPAKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SACOL0481 YP_185371.1 hypothetical protein Not tested vSa¥á Protein 5e-119 100
SAS0400 YP_042526.1 hypothetical protein Not tested vSa¥á Protein 2e-105 92
lpl11 NP_645215.1 hypothetical protein Not tested vSa¥á Protein 2e-105 92
SAUSA300_0414 YP_493127.1 tandem lipoprotein Not tested vSa¥á Protein 3e-104 92
SAR0442 YP_039891.1 hypothetical protein Not tested vSa¥á Protein 3e-104 91
lpl4nm YP_001331441.1 tandem lipoprotein Not tested vSa¥á Protein 3e-103 91
SAUSA300_0410 YP_493124.1 tandem lipoprotein Not tested vSa¥á Protein 4e-103 86
lpl1nm YP_001331437.1 tandem lipoprotein Not tested vSa¥á Protein 6e-104 86
lpl14 NP_645218.1 hypothetical protein Not tested vSa¥á Protein 1e-86 86
SAR0439 YP_039890.1 lipoprotein Not tested vSa¥á Protein 1e-98 85
SAMSHR1132_03930 YP_005324914.1 hypothetical protein Not tested vSa¥á Protein 1e-99 85
SAKOR_00420 YP_008490604.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-101 84
lpl1 NP_370960.1 hypothetical protein Not tested vSa¥á Protein 2e-92 81
lpl1 NP_373647.1 hypothetical protein Virulence vSa¥á Protein 2e-92 81
lpl7 NP_370967.1 hypothetical protein Not tested vSa¥á Protein 9e-92 81
lpl7 NP_373654.1 hypothetical protein Not tested vSa¥á Protein 9e-92 81
SAKOR_00425 YP_008490609.1 Membrane lipoprotein Not tested vSa¥á Protein 9e-92 81
SAR0443 YP_039892.1 lipoprotein Not tested vSa¥á Protein 2e-91 80
lpl9 NP_370969.1 hypothetical protein Not tested vSa¥á Protein 2e-92 80
lpl9 NP_373656.1 hypothetical protein Not tested vSa¥á Protein 2e-92 80
SAS0403 YP_042529.1 lipoprotein Not tested vSa¥á Protein 3e-93 80
SAMSHR1132_03890 YP_005324910.1 putative lipoprotein Not tested vSa¥á Protein 7e-90 79
lpl7nm YP_001331444.1 tandem lipoprotein Not tested vSa¥á Protein 5e-91 79
SAUSA300_0417 YP_493130.1 tandem lipoprotein Not tested vSa¥á Protein 5e-91 79
lpl3nm YP_001331440.1 tandem lipoprotein Not tested vSa¥á Protein 2e-91 79
SAUSA300_0413 YP_493126.1 tandem lipoprotein Not tested vSa¥á Protein 2e-91 79
SACOL0484 YP_185374.1 hypothetical protein Not tested vSa¥á Protein 5e-91 79
SAV0440 NP_370964.1 hypothetical protein Not tested vSa¥á Protein 5e-91 79
lpl4 NP_373651.1 hypothetical protein Not tested vSa¥á Protein 2e-91 79
SAKOR_00428 YP_008490612.1 Membrane lipoprotein Not tested vSa¥á Protein 9e-94 79
SAMSHR1132_03940 YP_005324915.1 putative lipoprotein Not tested vSa¥á Protein 8e-93 78
SAKOR_00423 YP_008490607.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-85 78
SAUSA300_0411 YP_493125.1 tandem lipoprotein Not tested vSa¥á Protein 1e-87 76
lpl2nm YP_001331438.1 tandem lipoprotein Not tested vSa¥á Protein 1e-87 76
SAMSHR1132_03860 YP_005324907.1 putative lipoprotein Not tested vSa¥á Protein 7e-90 76
SAMSHR1132_03840 YP_005324905.1 putative lipoprotein Not tested vSa¥á Protein 4e-85 67
SAKOR_00422 YP_008490606.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-80 67
SAR0438 YP_039889.1 lipoprotein Not tested vSa¥á Protein 2e-80 67
SAMSHR1132_03900 YP_005324911.1 putative lipoprotein Not tested vSa¥á Protein 3e-72 66
SAS0401 YP_042527.1 lipoprotein Not tested vSa¥á Protein 1e-73 65
lpl12 NP_645216.1 hypothetical protein Not tested vSa¥á Protein 1e-73 65
lpl2 NP_370961.1 hypothetical protein Not tested vSa¥á Protein 7e-77 65
lpl2 NP_373648.1 hypothetical protein Virulence vSa¥á Protein 7e-77 65
SAS0399 YP_042525.1 lipoprotein Not tested vSa¥á Protein 3e-80 65
lpl10 NP_645214.1 hypothetical protein Not tested vSa¥á Protein 3e-80 65
lpl6 NP_370966.1 hypothetical protein Not tested vSa¥á Protein 5e-75 65
lpl6 NP_373653.1 hypothetical protein Not tested vSa¥á Protein 5e-75 65
SAKOR_00424 YP_008490608.1 Membrane lipoprotein Not tested vSa¥á Protein 8e-68 65
lpl9nm YP_001331446.1 tandem lipoprotein Not tested vSa¥á Protein 4e-75 63
SACOL0486 YP_185376.1 hypothetical protein Not tested vSa¥á Protein 5e-75 63
SAUSA300_0419 YP_493132.1 tandem lipoprotein Not tested vSa¥á Protein 7e-75 62
SAMSHR1132_03870 YP_005324908.1 putative lipoprotein Not tested vSa¥á Protein 4e-73 61
lpl3 NP_370962.1 hypothetical protein Not tested vSa¥á Protein 2e-64 60
lpl3 NP_373649.1 hypothetical protein Virulence vSa¥á Protein 2e-64 60
SAMSHR1132_03880 YP_005324909.1 putative lipoprotein Not tested vSa¥á Protein 4e-64 60
lpl5 NP_370965.1 hypothetical protein Not tested vSa¥á Protein 9e-58 57
lpl5 NP_373652.1 hypothetical protein Not tested vSa¥á Protein 9e-58 57
SAS0402 YP_042528.1 lipoprotein Not tested vSa¥á Protein 3e-57 56
lpl13 NP_645217.1 hypothetical protein Not tested vSa¥á Protein 3e-57 56
SACOL0485 YP_185375.1 hypothetical protein Not tested vSa¥á Protein 7e-52 56
lpl8nm YP_001331445.1 tandem lipoprotein Not tested vSa¥á Protein 7e-52 56
SAUSA300_0418 YP_493131.1 tandem lipoprotein Not tested vSa¥á Protein 7e-52 56
SAKOR_00421 YP_008490605.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-57 55
SAR0444 YP_039893.1 lipoprotein Not tested vSa¥á Protein 5e-54 54
lpl8 NP_370968.1 hypothetical protein Not tested vSa¥á Protein 3e-49 54
lpl8 NP_373655.1 hypothetical protein Not tested vSa¥á Protein 3e-49 54
unnamed AAL26686.1 unknown Not tested SCCcap1 Protein 1e-53 53
SAMSHR1132_03850 YP_005324906.1 putative lipoprotein Not tested vSa¥á Protein 6e-58 53
SACOL0483 YP_185373.1 staphyloccoccus tandem lipoprotein Not tested vSa¥á Protein 8e-54 52
lpl6nm YP_001331443.1 tandem lipoprotein Not tested vSa¥á Protein 8e-54 52
SAUSA300_0416 YP_493129.1 tandem lipoprotein Not tested vSa¥á Protein 8e-54 52
SAMSHR1132_03920 YP_005324913.1 putative lipoprotein Not tested vSa¥á Protein 1e-52 52
SAMSHR1132_03910 YP_005324912.1 putative lipoprotein Not tested vSa¥á Protein 3e-53 51
SACOL0482 YP_185372.1 hypothetical protein Not tested vSa¥á Protein 9e-52 51
lpl5nm YP_001331442.1 tandem lipoprotein Not tested vSa¥á Protein 9e-52 51
SAR0445 YP_039894.1 lipoprotein Not tested vSa¥á Protein 1e-58 51
lpl3 YP_493128.1 tandem lipoprotein Not tested vSa¥á Protein 2e-51 50