Gene Information

Name : SACOL0040 (SACOL0040)
Accession : YP_184951.1
Strain : Staphylococcus aureus COL
Genome accession: NC_002951
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 45536 - 45886 bp
Length : 351 bp
Strand : -
Note : identified by similarity to GB:AAO03652.1; match to protein family HMM PF06106

DNA sequence :
ATGAAAACAACCACTCAAGAACTCAAACAATATATAACTCGTCTATTCCAACTATCTAACAATGAAACATGGGAATGTGA
AGCGTTAGAAGAAGCAGCAGAAAATATACTTCCTACTCGCTTTGTAGACCATACCCCACTTGCGCATCTTACACTTGACA
CTTATACCTACTATAATGATGAGCTACATGAGCTAAGTATCTATCCATTTCTAATGTACACCAATAACCAACTCATCAGT
ATCGGTTATCTGGATCATTTTGACATGGACTTTTTATATCTCACAGATACTAAAAATACGATTATCGATGAACGTCATCT
ACTAAAAGAAGGAGGGACTCGCCATGAATAA

Protein sequence :
MKTTTQELKQYITRLFQLSNNETWECEALEEAAENILPTRFVDHTPLAHLTLDTYTYYNDELHELSIYPFLMYTNNQLIS
IGYLDHFDMDFLYLTDTKNTIIDERHLLKEGGTRHE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed BAA94329.1 hypothetical protein Not tested Type-I SCCmec Protein 2e-49 100
SACOL0040 YP_184951.1 hypothetical protein Not tested Type-I SCCmec Protein 3e-49 100
SAS0031 YP_042164.1 hypothetical protein Not tested SCC476 Protein 6e-41 97
unnamed BAB83488.1 - Not tested SCC 12263 Protein 2e-47 94
SE0055 NP_763610.1 hypothetical protein Not tested SCCpbp4 Protein 3e-40 89
SAR0058 YP_039529.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-41 89
unnamed BAA94661.1 - Not tested Type-II SCCmec Protein 1e-41 89
SA0056 NP_373296.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-41 89
SERP2501 YP_190043.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-41 89
SAV0060 NP_370584.1 hypothetical protein Not tested Type-II SCCmec Protein 6e-41 88
MW0037 NP_644852.1 hypothetical protein Not tested Type-IV SCCmec Protein 2e-37 86
unnamed BAB72110.1 hypothetical protein Not tested Type-IVa SCCmec Protein 1e-37 86
unnamed BAB72129.1 hypothetical protein Not tested Type-IVb SCCmec Protein 1e-37 86
unnamed BAC67562.1 hypothetical protein Not tested Type-IVc SCCmec Protein 1e-37 86
SAMSHR1132_00390 YP_005324562.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 2e-37 86
SE0033 NP_763588.1 hypothetical protein Not tested SCCpbp4 Protein 8e-37 85
unnamed BAD24835.1 hypothetical protein Not tested Type-V SCCmec Protein 2e-30 55
SH0057 YP_251972.1 hypothetical protein Not tested SCCmec Protein 8e-30 55
SAPIG0051 YP_005732861.1 hypothetical protein Not tested Type-V SCCmec Protein 5e-30 55
unnamed BAG06213.1 hypothetical protein Not tested Type-VII SCCmec Protein 2e-30 54
unnamed ACL99845.1 hypothetical protein Not tested Type-V SCCmec Protein 2e-30 54
unnamed ACL99833.1 hypothetical protein Not tested Type-V SCCmec Protein 1e-25 53
unnamed BAG06192.1 hypothetical protein Not tested Type-VII SCCmec Protein 1e-25 53
unnamed BAB46981.2 hypothetical protein Not tested Type-IIIinv SCCmec Protein 6e-28 53
unnamed AAL26663.1 unknown Not tested SCCcap1 Protein 8e-26 53
SSP0034 YP_300124.1 hypothetical protein Not tested SCC15305RM Protein 2e-25 52
unnamed BAB47598.1 hypothetical protein Not tested Type-III SCCmec Protein 3e-26 51
unnamed BAB47671.1 hypothetical protein Not tested Type-III SCCmec Protein 7e-24 51
unnamed BAC53833.1 hypothetical protein Not tested SRImec-III and SCCmec-III region Protein 7e-24 51
SSP0047 YP_300137.1 hypothetical protein Not tested SCC15305cap Protein 2e-24 51
SARLGA251_00350 YP_005754050.1 hypothetical protein Not tested Type-XI SCCmec Protein 4e-24 50