Gene Information

Name : SACOL0038 (SACOL0038)
Accession : YP_184949.1
Strain : Staphylococcus aureus COL
Genome accession: NC_002951
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 45138 - 45449 bp
Length : 312 bp
Strand : -
Note : identified by match to protein family HMM PF06124

DNA sequence :
ATGAACATCAATCGATATATCACAAGAGGCATTAGTGAACACCTATCTCTAGATCTTCAAATCTTACTTTGGAACATGGT
AAAAGAAAGAGATAATCAACCTGATACAGATTACCTACACATTTTTAGACTGAAAGAAGATGAGAATATACTTTCAATCA
TACATGAGCAAGAACAACCCACGTACAAATTGGAATATCACTATACAAACTATATAAAAAATCAAAATGCATTACCTAAG
AAAGTCTACGTCATCCGAGAAGATGATGTAGATGTTTTTTATTATGTGATGCTTTTACCAGAAGAATACTAA

Protein sequence :
MNINRYITRGISEHLSLDLQILLWNMVKERDNQPDTDYLHIFRLKEDENILSIIHEQEQPTYKLEYHYTNYIKNQNALPK
KVYVIREDDVDVFYYVMLLPEEY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SACOL0038 YP_184949.1 hypothetical protein Not tested Type-I SCCmec Protein 6e-43 100
unnamed BAA94330.1 hypothetical protein Not tested Type-I SCCmec Protein 2e-43 100
unnamed BAB46980.2 hypothetical protein Not tested Type-IIIinv SCCmec Protein 4e-40 94
SE0053 NP_763608.1 hypothetical protein Not tested SCCpbp4 Protein 6e-41 93
SH0058 YP_251973.1 hypothetical protein Not tested SCCmec Protein 4e-40 92
unnamed BAB83490.1 - Not tested SCC 12263 Protein 8e-41 92
unnamed BAD24837.1 hypothetical protein Not tested Type-V SCCmec Protein 4e-40 92
SERP2503 YP_190045.1 hypothetical protein Not tested Type-II SCCmec Protein 8e-40 91
SAR0057 YP_039528.1 hypothetical protein Not tested Type-II SCCmec Protein 8e-40 91
SAV0059 NP_370583.1 hypothetical protein Not tested Type-II SCCmec Protein 8e-40 91
unnamed BAA94662.1 - Not tested Type-II SCCmec Protein 5e-40 91
SA0055 NP_373295.1 hypothetical protein Not tested Type-II SCCmec Protein 8e-40 91
SAS0030 YP_042163.1 hypothetical protein Not tested SCC476 Protein 2e-39 90
SAPIG0052 YP_005732862.1 hypothetical protein Not tested Type-V SCCmec Protein 7e-40 89
unnamed BAG06214.1 hypothetical protein Not tested Type-VII SCCmec Protein 3e-40 89
unnamed ACL99846.1 hypothetical protein Not tested Type-V SCCmec Protein 3e-39 88
SE0031 NP_763586.1 hypothetical protein Not tested SCCpbp4 Protein 6e-39 87
SAMSHR1132_00370 YP_005324561.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 6e-38 86
MW0036 NP_644851.1 hypothetical protein Not tested Type-IV SCCmec Protein 6e-38 86
unnamed BAB72111.1 hypothetical protein Not tested Type-IVa SCCmec Protein 4e-38 86
unnamed BAB72130.1 hypothetical protein Not tested Type-IVb SCCmec Protein 4e-38 86
unnamed BAC67563.1 hypothetical protein Not tested Type-IVc SCCmec Protein 4e-38 86
unnamed ACL99834.1 hypothetical protein Not tested Type-V SCCmec Protein 2e-16 51
SSP0048 YP_300138.1 hypothetical protein Not tested SCC15305cap Protein 6e-18 51
unnamed BAG06193.1 hypothetical protein Not tested Type-VII SCCmec Protein 2e-16 51
SAPIG0036 YP_005732846.1 hypothetical protein Not tested Type-V SCCmec Protein 3e-16 51
unnamed BAB47670.1 hypothetical protein Not tested Type-III SCCmec Protein 2e-16 50
unnamed BAC53832.1 hypothetical protein Not tested SRImec-III and SCCmec-III region Protein 2e-16 50
SARLGA251_00340 YP_005754049.1 hypothetical protein Not tested Type-XI SCCmec Protein 5e-16 49
unnamed BAB47601.1 hypothetical protein Not tested Type-III SCCmec Protein 1e-16 49
SSP0032 YP_300122.1 hypothetical protein Not tested SCC15305RM Protein 1e-14 46
unnamed AAL26664.1 unknown Not tested SCCcap1 Protein 6e-11 44