Gene Information

Name : SACOL0037 (SACOL0037)
Accession : YP_184948.1
Strain : Staphylococcus aureus COL
Genome accession: NC_002951
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : S : Function unknown
COG ID : COG4333
EC number : -
Position : 44617 - 45123 bp
Length : 507 bp
Strand : -
Note : identified by similarity to GB:AAO03627.1

DNA sequence :
ATGAATACAATCAAAAGTACGATAAACACAGAAGCCATATTTAGCGATGATGAACAACACCGCTATTTACTCAAGAAAAC
ATGGGATGAAAAGAAACCCGCTTGTACAGTGATAACGATGTACCCTCATTTAGATGGTGTATTATCACTCGATCTCACAA
CTGTTCTTATCCTCAATCAATTAGCTAATACTGAACAATATGGTGCTGTATATCTTGTAAATCTATTTTCAAATATTAGA
ACACCCGAAAACCTCAAACATATCAAAAATCCATACGATGAGCACACTGATATTCATTTGATGAAAGCGATTAGTGAAAG
TGACACAGTGATTCTTGCTTATGGTGCCTATGCGAAGCGACCAGTTGTTATCGACCGTGTCGAACAAGTGATGGAAATGT
TAAAACCTCATAAAAAGAAAGTAAAAAAGCTCATCAATCCAGTAACAAATGAAATTATGCATCCACTCAACCCTAAGGCA
CGTCAAAAATGGATTTTGAAATCATAG

Protein sequence :
MNTIKSTINTEAIFSDDEQHRYLLKKTWDEKKPACTVITMYPHLDGVLSLDLTTVLILNQLANTEQYGAVYLVNLFSNIR
TPENLKHIKNPYDEHTDIHLMKAISESDTVILAYGAYAKRPVVIDRVEQVMEMLKPHKKKVKKLINPVTNEIMHPLNPKA
RQKWILKS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SACOL0037 YP_184948.1 hypothetical protein Not tested Type-I SCCmec Protein 6e-70 100
unnamed BAA94331.1 hypothetical protein Not tested Type-I SCCmec Protein 4e-70 100
MW0035 NP_644850.1 hypothetical protein Not tested Type-IV SCCmec Protein 6e-69 98
SAUSA300_0036 YP_492756.1 hypothetical protein Not tested Type-IV SCCmec Protein 6e-69 98
unnamed BAB72112.1 hypothetical protein Not tested Type-IVa SCCmec Protein 4e-69 98
unnamed BAB72131.1 hypothetical protein Not tested Type-IVb SCCmec Protein 4e-69 98
unnamed BAC67564.1 hypothetical protein Not tested Type-IVc SCCmec Protein 4e-69 98
SAMSHR1132_00360 YP_005324560.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 6e-69 98
unnamed BAG06215.2 hypothetical protein Not tested Type-VII SCCmec Protein 1e-67 95
unnamed ACL99847.1 hypothetical protein Not tested Type-V SCCmec Protein 9e-68 95
SAS0029 YP_042162.1 hypothetical protein Not tested SCC476 Protein 9e-67 94
SH0059 YP_251974.1 hypothetical protein Not tested SCCmec Protein 5e-66 93
SE0030 NP_763585.1 hypothetical protein Not tested SCCpbp4 Protein 5e-67 93
SAPIG0053 YP_005732863.1 hypothetical protein Not tested Type-V SCCmec Protein 1e-58 93
unnamed BAA94663.1 - Not tested Type-II SCCmec Protein 6e-66 92
SAR0056 YP_039527.1 hypothetical protein Not tested Type-II SCCmec Protein 8e-66 92
unnamed BAD24838.1 hypothetical protein Not tested Type-V SCCmec Protein 1e-67 92
SERP2504 YP_190046.1 hypothetical protein Not tested Type-II SCCmec Protein 8e-66 92
SAV0058 NP_370582.1 hypothetical protein Not tested Type-II SCCmec Protein 1e-65 92
SA0054 NP_373294.1 hypothetical protein Not tested Type-II SCCmec Protein 1e-65 92
SAPIG0037 YP_005732847.1 hypothetical protein Not tested Type-V SCCmec Protein 3e-49 69
unnamed ACL99835.1 hypothetical protein Not tested Type-V SCCmec Protein 2e-49 69
unnamed BAG06194.1 hypothetical protein Not tested Type-VII SCCmec Protein 2e-49 69
unnamed BAB46979.2 hypothetical protein Not tested Type-IIIinv SCCmec Protein 6e-49 68
unnamed BAB47669.1 hypothetical protein Not tested Type-III SCCmec Protein 3e-49 68
SARLGA251_00330 YP_005754048.1 hypothetical protein Not tested Type-XI SCCmec Protein 1e-49 68
unnamed BAC53831.1 hypothetical protein Not tested SRImec-III and SCCmec-III region Protein 3e-49 68
SSP0031 YP_300121.1 hypothetical protein Not tested SCC15305RM Protein 2e-44 65
SSP0049 YP_300139.1 hypothetical protein Not tested SCC15305cap Protein 7e-44 64
unnamed BAB47602.1 hypothetical protein Not tested Type-III SCCmec Protein 1e-44 62
unnamed BAB46974.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 1e-44 62