Name : SACOL0361 (SACOL0361) Accession : YP_185253.1 Strain : Staphylococcus aureus COL Genome accession: NC_002951 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 372155 - 372307 bp Length : 153 bp Strand : + Note : identified by similarity to GP:12697854; match to protein family HMM PF06116 DNA sequence : ATGACTAAACAAATATTAAGACTATTATTCTTACTAGCAATGTATGAGTTAGGTAAGTATGTAACTGAGCAAGTGTATAT TATGATGACGGCTAATGATGATGTAGAGGCGCCGAGTGATTACGAAAAAATCAGAGCTGAAGTTTCATGGTAA Protein sequence : MTKQILRLLFLLAMYELGKYVTEQVYIMMTANDDVEAPSDYEKIRAEVSW |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
SAUSA300_1412 | YP_494109.1 | phiSLT ORF 50-like protein | Not tested | ¥ÕSa2 | Protein | 2e-17 | 98 |
SAOV_0310 | YP_005735827.1 | transcriptional activator rinB | Not tested | ¥ÕSa1 | Protein | 7e-17 | 94 |
MW1411 | NP_646228.1 | hypothetical protein | Not tested | ¥ÕSa2 | Protein | 7e-17 | 94 |
SAV1971 | NP_372495.2 | hypothetical protein | Not tested | ¥ÕSa3 | Protein | 6e-11 | 93 |
MW1916 | NP_646733.1 | hypothetical protein | Not tested | ¥ÕSa3 | Protein | 6e-14 | 92 |
SAS062 | NP_375080.1 | hypothetical protein | Not tested | ¥ÕSa3 | Protein | 6e-14 | 92 |
SAUSA300_1946 | YP_494597.1 | phiPVL ORF057-like protein, transcriptional activator RinB | Not tested | ¥ÕSa3 | Protein | 6e-14 | 92 |
SAUSA300_1946 | YP_494597.1 | phiPVL ORF057-like protein, transcriptional activator RinB | Not tested | ¥ÕSa3 | Protein | 6e-14 | 92 |
SAKOR_01951 | YP_008492139.1 | Transcriptional activator rinB | Not tested | ¥ÕSa3 | Protein | 6e-14 | 92 |
SAOV_1096 | YP_005736591.1 | Transcriptional activator, phage associated | Not tested | ¥ÕSa2 | Protein | 2e-13 | 90 |
SAOV_1937c | YP_005737381.1 | transcriptional activator rinB | Not tested | ¥ÕSa3 | Protein | 2e-13 | 90 |
SAV0882 | NP_371406.1 | int gene activator RinB | Not tested | ¥ÕSa1 | Protein | 2e-13 | 81 |