
|
Name : SACOL0029 (SACOL0029) Accession : YP_184940.1 Strain : Staphylococcus aureus COL Genome accession: NC_002951 Putative virulence/resistance : Unknown Product : HMG-CoA synthase, truncation Function : - COG functional category : I : Lipid transport and metabolism COG ID : COG3425 EC number : - Position : 37285 - 37452 bp Length : 168 bp Strand : + Note : identified by similarity to GP:9937361 DNA sequence : ATGCTAGAATCTAGAGAGCAATTATCAGTCGAAGAATACGAAACATTCTTTAACAGATTTGATAATCAAGAATTTGATTT CGAACGTGAATTGACACAAGATCCATATTCAAAAGTATACTTATACAGTATAGAAGACCATATCAGAACATATAAGATAG AGAAATAA Protein sequence : MLESREQLSVEEYETFFNRFDNQEFDFERELTQDPYSKVYLYSIEDHIRTYKIEK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SAUSA300_0029 | YP_492749.1 | hypothetical protein | Not tested | Type-IV SCCmec | Protein | 2e-19 | 100 |
| SERP2525 | YP_190066.1 | HMG-CoA synthase, truncation | Not tested | Type-II SCCmec | Protein | 2e-19 | 100 |
| SH0088 | YP_252003.1 | hypothetical protein | Not tested | SCCmec | Protein | 2e-19 | 100 |
| unnamed | BAA94337.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 2e-19 | 100 |
| unnamed | BAB47630.1 | hypothetical protein | Not tested | Type-III SCCmec | Protein | 2e-19 | 100 |
| SACOL0029 | YP_184940.1 | HMG-CoA synthase, truncation | Not tested | Type-I SCCmec | Protein | 2e-19 | 100 |
| unnamed | BAA82227.2 | - | Not tested | Type-II SCCmec | Protein | 2e-19 | 100 |
| SAMSHR1132_00290 | YP_005324553.1 | HMG-CoA synthase (partial) | Not tested | Type-IIIinv SCCmec | Protein | 2e-19 | 100 |
| unnamed | BAG06196.1 | hypothetical protein | Not tested | Type-VII SCCmec | Protein | 2e-19 | 100 |
| MW0028 | NP_644843.1 | HMG-CoA synthase | Not tested | Type-IV SCCmec | Protein | 2e-19 | 100 |
| SAPIG0039 | YP_005732849.1 | probable HMG-CoA synthase | Not tested | Type-V SCCmec | Protein | 2e-19 | 100 |