Gene Information

Name : SACOL0029 (SACOL0029)
Accession : YP_184940.1
Strain : Staphylococcus aureus COL
Genome accession: NC_002951
Putative virulence/resistance : Unknown
Product : HMG-CoA synthase, truncation
Function : -
COG functional category : I : Lipid transport and metabolism
COG ID : COG3425
EC number : -
Position : 37285 - 37452 bp
Length : 168 bp
Strand : +
Note : identified by similarity to GP:9937361

DNA sequence :
ATGCTAGAATCTAGAGAGCAATTATCAGTCGAAGAATACGAAACATTCTTTAACAGATTTGATAATCAAGAATTTGATTT
CGAACGTGAATTGACACAAGATCCATATTCAAAAGTATACTTATACAGTATAGAAGACCATATCAGAACATATAAGATAG
AGAAATAA

Protein sequence :
MLESREQLSVEEYETFFNRFDNQEFDFERELTQDPYSKVYLYSIEDHIRTYKIEK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SH0088 YP_252003.1 hypothetical protein Not tested SCCmec Protein 2e-19 100
unnamed BAA94337.1 hypothetical protein Not tested Type-I SCCmec Protein 2e-19 100
unnamed BAB47630.1 hypothetical protein Not tested Type-III SCCmec Protein 2e-19 100
SACOL0029 YP_184940.1 HMG-CoA synthase, truncation Not tested Type-I SCCmec Protein 2e-19 100
unnamed BAA82227.2 - Not tested Type-II SCCmec Protein 2e-19 100
SAMSHR1132_00290 YP_005324553.1 HMG-CoA synthase (partial) Not tested Type-IIIinv SCCmec Protein 2e-19 100
unnamed BAG06196.1 hypothetical protein Not tested Type-VII SCCmec Protein 2e-19 100
MW0028 NP_644843.1 HMG-CoA synthase Not tested Type-IV SCCmec Protein 2e-19 100
SAPIG0039 YP_005732849.1 probable HMG-CoA synthase Not tested Type-V SCCmec Protein 2e-19 100
SAUSA300_0029 YP_492749.1 hypothetical protein Not tested Type-IV SCCmec Protein 2e-19 100
SERP2525 YP_190066.1 HMG-CoA synthase, truncation Not tested Type-II SCCmec Protein 2e-19 100