Name : epiA (SACOL1878) Accession : YP_186705.1 Strain : Staphylococcus aureus COL Genome accession: NC_002951 Putative virulence/resistance : Virulence Product : lantibiotic epidermin precursor EpiA Function : - COG functional category : - COG ID : - EC number : - Position : 1931885 - 1932028 bp Length : 144 bp Strand : - Note : identified by similarity to EGAD:6281; match to protein family HMM PF02052 DNA sequence : ATGGAAAAAGTTCTTGATTTAGACGTGCAAGTTAAAGCAAACAATAACTCAAATGATTCAGCAGGTGACGAACGTATTAC AAGTCATAGTTTATGTACTCCTGGTTGTGCTAAGACTGGTAGTTTTAATAGCTTCTGCTGTTAA Protein sequence : MEKVLDLDVQVKANNNSNDSAGDERITSHSLCTPGCAKTGSFNSFCC |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
bsaA2 | YP_001332750.1 | lantibiotic precursor | Not tested | vSa¥â | Protein | 3e-15 | 100 |
epiA | YP_494458.1 | lantibiotic epidermin biosynthesis protein EpiA | Not tested | vSa¥â | Protein | 3e-15 | 100 |
epiA | YP_186705.1 | lantibiotic epidermin precursor EpiA | Virulence | vSa¥â | Protein | 3e-15 | 100 |
bsaA2 | NP_646582.1 | hypothetical protein | Not tested | vSa¥â | Protein | 3e-15 | 100 |
bsaA1 | NP_646583.1 | hypothetical protein | Not tested | vSa¥â | Protein | 2e-12 | 86 |
bsaA1 | YP_001332751.1 | lantibiotic precursor | Not tested | vSa¥â | Protein | 2e-12 | 86 |