Gene Information

Name : czrR-2 (PP_1438)
Accession : NP_743596.1
Strain : Pseudomonas putida KT2440
Genome accession: NC_002947
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator CzrR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1638732 - 1639406 bp
Length : 675 bp
Strand : -
Note : similar to GP:12484568; identified by sequence similarity

DNA sequence :
ATGCGCCTACTGATCATCGAGGACGAGCTGCGTACCGCCGACTACCTGCAACAGGGCCTTCGCGAGAACGGTTACGTGGT
CGACTGCGCCCACACAGGCACCGACGGCCTGCACCTGGCACGCCAACAGGCGTATGACCTGGTCATCCTCGACGTCAACC
TGCCCGAAATCGATGGCTGGACCGTGCTGCAGCGGCTACGTGCCGAATCGGCCACACGCATCATGATGCTGACCGCCCAC
GGTCGCTTGGCCGACCGGGTAAAAGGCCTGGACCTGGGCGCGGATGACTACCTGCTCAAGCCCTTTGAGTTCCCTGAGCT
ACTGGCGCGCATCCGCAGCCTGCTACGCCGCAACGACCAGCAACTGCAGCCCAGCACCCTGCGCGTCGCTGACCTGGAAC
TGGACCCCGGCCGCCACCGCGCCTACCGCGCCGGGCAGCGCATCGACCTGACCGCCAAGGAGTTCGCCCTGCTGCACCTG
CTAATGCGCCAGACTGGCGAAGTGTTGTCGCGCACGCAGATCATCTCGCTGGTGTGGGACATGAACTTCGACTGCGACAC
CAACGTGGTCGAGGTCTCGATCCGGCGCCTGCGGGCGAAGATCGACGACCCGTTCGACAACAAGCTGATCCATACCCTGC
GTGGTGTGGGCTACGTACTTGAGGCTCGCCTTTGA

Protein sequence :
MRLLIIEDELRTADYLQQGLRENGYVVDCAHTGTDGLHLARQQAYDLVILDVNLPEIDGWTVLQRLRAESATRIMMLTAH
GRLADRVKGLDLGADDYLLKPFEFPELLARIRSLLRRNDQQLQPSTLRVADLELDPGRHRAYRAGQRIDLTAKEFALLHL
LMRQTGEVLSRTQIISLVWDMNFDCDTNVVEVSIRRLRAKIDDPFDNKLIHTLRGVGYVLEARL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-55 52
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-55 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czrR-2 NP_743596.1 DNA-binding response regulator CzrR BAC0083 Protein 1e-61 60
czrR-2 NP_743596.1 DNA-binding response regulator CzrR BAC0125 Protein 6e-66 60
czrR-2 NP_743596.1 DNA-binding response regulator CzrR BAC0197 Protein 3e-64 59
czrR-2 NP_743596.1 DNA-binding response regulator CzrR BAC0638 Protein 1e-55 59
czrR-2 NP_743596.1 DNA-binding response regulator CzrR BAC0308 Protein 3e-57 55
czrR-2 NP_743596.1 DNA-binding response regulator CzrR BAC0111 Protein 8e-62 55
czrR-2 NP_743596.1 DNA-binding response regulator CzrR BAC0347 Protein 7e-58 51
czrR-2 NP_743596.1 DNA-binding response regulator CzrR NC_010079.5776364.p0 Protein 7e-38 44
czrR-2 NP_743596.1 DNA-binding response regulator CzrR NC_002952.2859858.p0 Protein 7e-38 44
czrR-2 NP_743596.1 DNA-binding response regulator CzrR NC_007622.3794948.p0 Protein 7e-38 44
czrR-2 NP_743596.1 DNA-binding response regulator CzrR NC_003923.1003417.p0 Protein 7e-38 44
czrR-2 NP_743596.1 DNA-binding response regulator CzrR NC_013450.8614146.p0 Protein 7e-38 44
czrR-2 NP_743596.1 DNA-binding response regulator CzrR NC_002951.3238224.p0 Protein 7e-38 44
czrR-2 NP_743596.1 DNA-binding response regulator CzrR NC_007793.3914065.p0 Protein 7e-38 44
czrR-2 NP_743596.1 DNA-binding response regulator CzrR NC_002758.1121390.p0 Protein 7e-38 44
czrR-2 NP_743596.1 DNA-binding response regulator CzrR AE015929.1.gene1106. Protein 2e-32 42
czrR-2 NP_743596.1 DNA-binding response regulator CzrR U82965.2.orf14.gene. Protein 1e-33 42
czrR-2 NP_743596.1 DNA-binding response regulator CzrR AE000516.2.gene3505. Protein 1e-28 42
czrR-2 NP_743596.1 DNA-binding response regulator CzrR CP001918.1.gene5135. Protein 4e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czrR-2 NP_743596.1 DNA-binding response regulator CzrR VFG0596 Protein 6e-56 52
czrR-2 NP_743596.1 DNA-binding response regulator CzrR VFG1389 Protein 5e-36 44
czrR-2 NP_743596.1 DNA-binding response regulator CzrR VFG1386 Protein 4e-38 43
czrR-2 NP_743596.1 DNA-binding response regulator CzrR VFG1390 Protein 7e-38 42
czrR-2 NP_743596.1 DNA-binding response regulator CzrR VFG0473 Protein 9e-31 41