|
Name : rpmG (MAP4106) Accession : NP_963040.1 Strain : Mycobacterium avium K-10 Genome accession: NC_002944 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L33 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0267 EC number : - Position : 4580263 - 4580430 bp Length : 168 bp Strand : + Note : in Escherichia coli BM108, a mutation that results in lack of L33 synthesis had no effect on ribosome synthesis or function; there are paralogous genes in several bacterial genomes, and a CXXC motif for zinc binding and an upstream regulation region of th DNA sequence : ATGGCTTCCAGTACCGACGTACGGCCGAAAATCACCTTGGCGTGCGAGGTGTGCAAGCACCGCAACTACATCACCAAGAA AAACCGCCGGAACGACCCGGACCGACTGGAGCTGAAGAAGTACTGCCCCAACTGCGGTAAGCACCAGGCGCATCGGGAGA CACGCTAG Protein sequence : MASSTDVRPKITLACEVCKHRNYITKKNRRNDPDRLELKKYCPNCGKHQAHRETR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmG | NP_814353.1 | 50S ribosomal protein L33 | Not tested | Not named | Protein | 2e-05 | 41 |
| ef0106 | AAM75309.1 | EF0106 | Not tested | Not named | Protein | 1e-05 | 41 |
