Gene Information

Name : GSU3118 (GSU3118)
Accession : NP_954159.1
Strain : Geobacter sulfurreducens PCA
Genome accession: NC_002939
Putative virulence/resistance : Virulence
Product : winged-helix transcriptional response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3420184 - 3420867 bp
Length : 684 bp
Strand : -
Note : domains: REC, trans_reg_C

DNA sequence :
ATGACCGGAACGATTCTCATTGTGGAGGACGAGGAGAAGATTGCCACCCTGCTGCGCGATTATCTGCGATTGGCGGGATT
TGACGTCTGTTGTCTGGCGGGAGGTGCCGAGGCTGCGCCGTGGGTGCGCGAACATGCACCGGACCTCGTTCTGCTCGACC
TGATGCTGCCGGGCCGCGATGGCCTGGAGATCTGCAAGGATGTCCGCGTCTTTTCCAGTGTGCCGATCATCATGATCACG
GCGCGGATCGAGGAGATCGACCGCCTGCTCGGCCTTGAACTGGGGGCGGACGACTACATCTGCAAGCCCTTCAGTCCCCG
CGAGGTGGTGGCGCGGGTGAAGGCGGTCCTGCGCCGTAGCGGACCGGGTCAGACAACGGCACTGGCCGGTCTCGTCATGG
ACGGGGCATGCTACCGTGCCGCCCTTGACGGTCACGAACTGGATTTGACCGCCGTCGAGTTCAAGCTTCTCCAGTTCCTG
GCGGCCAGCCCCGGCAGGATCTACAGCCGCCAGCAACTCATGGACCGCATCTACCCCGACGAGCGGGTGGTTGCCGACCG
TACCATCGACAGCCACATCAAAAAACTGCGGAAAAAGATCGCGGATGTCGCTCCCGGCGAGGATCTGATCCATTCAGTGT
ACGGGGTGGGGTACAAGTTCGAACGGGCATCGCGCCGCGAATGA

Protein sequence :
MTGTILIVEDEEKIATLLRDYLRLAGFDVCCLAGGAEAAPWVREHAPDLVLLDLMLPGRDGLEICKDVRVFSSVPIIMIT
ARIEEIDRLLGLELGADDYICKPFSPREVVARVKAVLRRSGPGQTTALAGLVMDGACYRAALDGHELDLTAVEFKLLQFL
AASPGRIYSRQQLMDRIYPDERVVADRTIDSHIKKLRKKIADVAPGEDLIHSVYGVGYKFERASRRE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-34 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GSU3118 NP_954159.1 winged-helix transcriptional response regulator NC_002695.1.916589.p Protein 2e-59 55
GSU3118 NP_954159.1 winged-helix transcriptional response regulator BAC0039 Protein 5e-60 55
GSU3118 NP_954159.1 winged-helix transcriptional response regulator CP001138.1.gene2239. Protein 7e-59 55
GSU3118 NP_954159.1 winged-helix transcriptional response regulator CP001918.1.gene3444. Protein 2e-59 55
GSU3118 NP_954159.1 winged-helix transcriptional response regulator CP000034.1.gene2186. Protein 5e-60 55
GSU3118 NP_954159.1 winged-helix transcriptional response regulator BAC0596 Protein 7e-59 55
GSU3118 NP_954159.1 winged-helix transcriptional response regulator CP000647.1.gene2531. Protein 3e-58 54
GSU3118 NP_954159.1 winged-helix transcriptional response regulator NC_010410.6002989.p0 Protein 2e-48 52
GSU3118 NP_954159.1 winged-helix transcriptional response regulator NC_011595.7057856.p0 Protein 2e-48 52
GSU3118 NP_954159.1 winged-helix transcriptional response regulator CP004022.1.gene1676. Protein 1e-55 52
GSU3118 NP_954159.1 winged-helix transcriptional response regulator NC_010400.5986590.p0 Protein 6e-47 51
GSU3118 NP_954159.1 winged-helix transcriptional response regulator HE999704.1.gene2815. Protein 4e-36 43
GSU3118 NP_954159.1 winged-helix transcriptional response regulator NC_002952.2859905.p0 Protein 2e-41 42
GSU3118 NP_954159.1 winged-helix transcriptional response regulator NC_007622.3794472.p0 Protein 2e-41 42
GSU3118 NP_954159.1 winged-helix transcriptional response regulator NC_009641.5332272.p0 Protein 2e-41 42
GSU3118 NP_954159.1 winged-helix transcriptional response regulator NC_013450.8614421.p0 Protein 2e-41 42
GSU3118 NP_954159.1 winged-helix transcriptional response regulator NC_007793.3914279.p0 Protein 2e-41 42
GSU3118 NP_954159.1 winged-helix transcriptional response regulator NC_003923.1003749.p0 Protein 2e-41 42
GSU3118 NP_954159.1 winged-helix transcriptional response regulator NC_002745.1124361.p0 Protein 2e-41 42
GSU3118 NP_954159.1 winged-helix transcriptional response regulator NC_009782.5559369.p0 Protein 2e-41 42
GSU3118 NP_954159.1 winged-helix transcriptional response regulator NC_002951.3237708.p0 Protein 2e-41 42
GSU3118 NP_954159.1 winged-helix transcriptional response regulator NC_002758.1121668.p0 Protein 2e-41 42
GSU3118 NP_954159.1 winged-helix transcriptional response regulator NC_012469.1.7686381. Protein 3e-33 41
GSU3118 NP_954159.1 winged-helix transcriptional response regulator NC_012469.1.7685629. Protein 6e-33 41
GSU3118 NP_954159.1 winged-helix transcriptional response regulator AE000516.2.gene3505. Protein 2e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GSU3118 NP_954159.1 winged-helix transcriptional response regulator VFG1563 Protein 3e-34 41
GSU3118 NP_954159.1 winged-helix transcriptional response regulator VFG1702 Protein 7e-34 41