Gene Information

Name : DVU1527 (DVU1527)
Accession : YP_010746.1
Strain : Desulfovibrio vulgaris Hildenborough
Genome accession: NC_002937
Putative virulence/resistance : Unknown
Product : phage integrase site specific recombinase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG0582
EC number : -
Position : 1594709 - 1595902 bp
Length : 1194 bp
Strand : -
Note : identified by match to protein family HMM PF00589

DNA sequence :
ATGCTCACGGACATCAAGGCCCGCGCGGCCAAACCAGCCGAGAAGGTATACCGCCTCTACGACGGCGGAGGGATGTATCT
TGAGGTGCCCCCATCGGGTAACAAGCGGTGGAGGCTCAAATACCGCGTCAACGGCAAAGAGAAGCGCCTGAGTCTTGGCG
TGTATCCCAATGTCGGGCTGAAAGAAGCGCGAGAGAAGCGAGACGAACTGCGCCGCCTCATCGCTGAGGGCATCGACCCC
GCAGCGCAACGTTGCCCCCAAAAAGTTGCCCCCACGGCGGACTCTTTCGAGATGGTGGCACGGGAATGGATGGATCTCCG
CTCTCCTGCCTGGGCACCCCGGCACCTCTCCACCACATGCCAGCGCCTTGAGGCCTACATCTTCCCCCACATCGGCCCGC
TCCCCATCGATCAGATCGGCCCTCTGGATGTGCTGAATGCCCTTCGCATCGTCGAGAAGCGTGGGGCTGTAGAAGCGGCA
AGGAAAACCCTGTCCATCTGCTCACAGGTCTTCAGGTATGCGGTGGCTTCGGCCCGCATCCAGAGCGACCCTTGCCGCGA
CCTTCGGGGGGCATTGAAAACGCGCCAGCCCGGTCACTATGCAGCCATCGTAGACCCGAAGGATGTAGGCGCCCTGATGC
GAGCGATAGACGGGTATTCGGGGGCAATGGTTGTGCGCTGCGCCCTTCGCTTCCTCGCACTGACCTTCGTTCGTCCCGGC
GAGCTCAGGGCTGCAGAATGGAACGAGTTCGACATGGAGCGCCGCATCTGGACAATCCCCGCCCACAAAATGAAGAAGCG
GCGAGAGCACATTGTGCCGCTATCGACACAGGCTCTCGCCGTTCTGCGCGATGTGCGCGCGACAGCACCTCGGCTGAATA
GTCCCATGGTGTTTCAGTCTGTCCGCCTCCGTAGCGATCGCGGACTGTCAGAGAACACCCTTCTGGTTGCGTTGCGCTCT
CTCGGTTACGGGCAGGGCACGATGACCGCCCATGGTTTTAGGGCCATGGCCTCCTCCCTTCTCAACGGCTTGGGCTACAA
TCCCGACGTGATCGAGAGGCAGCTTGCCCACATCGAAGGGAACAAAATCCGGGCCGCATACCATCGGACAGAGTATCTTG
AGGAGCGTACCGCTATGATGCAGGCATACGCGGACTATCTTGATTCTCTGAGGGATTCCATGCCCCCGAGATGA

Protein sequence :
MLTDIKARAAKPAEKVYRLYDGGGMYLEVPPSGNKRWRLKYRVNGKEKRLSLGVYPNVGLKEAREKRDELRRLIAEGIDP
AAQRCPQKVAPTADSFEMVAREWMDLRSPAWAPRHLSTTCQRLEAYIFPHIGPLPIDQIGPLDVLNALRIVEKRGAVEAA
RKTLSICSQVFRYAVASARIQSDPCRDLRGALKTRQPGHYAAIVDPKDVGALMRAIDGYSGAMVVRCALRFLALTFVRPG
ELRAAEWNEFDMERRIWTIPAHKMKKRREHIVPLSTQALAVLRDVRATAPRLNSPMVFQSVRLRSDRGLSENTLLVALRS
LGYGQGTMTAHGFRAMASSLLNGLGYNPDVIERQLAHIEGNKIRAAYHRTEYLEERTAMMQAYADYLDSLRDSMPPR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
int CAC39282.1 integrase Not tested LPA Protein 2e-79 43
aec33 AAW51716.1 Int Not tested AGI-3 Protein 1e-79 43
int AAD44730.1 Int Not tested SHI-2 Protein 5e-80 43
ECO111_3718 YP_003236059.1 putative integrase Not tested LEE Protein 3e-62 43
SF2964 NP_708738.1 P4-type integrase Not tested SHI-1 Protein 8e-64 43
ORF_1 AAZ04412.1 phage integrase Not tested PAI I APEC-O1 Protein 5e-63 43
APECO1_3534 YP_854214.1 P4-like integrase Not tested PAI I APEC-O1 Protein 6e-63 43
c5216 NP_757064.1 prophage P4 integrase Not tested PAI II CFT073 Protein 5e-63 43
ECUMN_3322 YP_002414004.1 integrase Not tested Not named Protein 3e-63 43
c3556 NP_755431.1 prophage P4 integrase Not tested PAI I CFT073 Protein 2e-63 43
S4822 NP_838459.1 P4-type integrase Not tested SHI-1 Protein 8e-64 43
int ADD91747.1 P4 integrase Not tested PAI-I AL862 Protein 6e-64 43
int AAT48697.1 CP4-like integrase Not tested PAI I 4787 Protein 4e-63 43
int AAL51003.1 CP4-like integrase Not tested LEE Protein 2e-63 43
intP4 CAE85151.1 CP4 integrase protein Not tested PAI V 536 Protein 1e-63 43
int AAK16198.1 Int Not tested PAI-I AL862 Protein 6e-64 43
ESA_03025 YP_001439090.1 hypothetical protein Not tested Not named Protein 4e-79 42
int AAC31482.1 CP4-like integrase Not tested LEE Protein 1e-79 42
intL NP_290239.1 integrase for prophage 933L and the LEE pathogenicity island Not tested LEE Protein 2e-79 42
int ACU09430.1 integrase Not tested LEE Protein 1e-79 42
ECs4534 NP_312561.1 integrase Not tested LEE Protein 2e-79 42
int AAD54663.1 Sai integrase Not tested SHI-2 Protein 4e-79 42
S4835 NP_839238.1 integrase Not tested SHI-2 Protein 5e-79 42
SF3698 NP_709437.1 integrase Not tested SHI-2 Protein 5e-79 42
int AAK00456.1 Int Not tested SHI-1 Protein 5e-56 42
int-phe AAL57571.1 CP4-like integrase Not tested LEE Protein 8e-63 42
int AAL51028.1 CP4-like integrase Not tested LEE Protein 8e-63 42
ECO103_3550 YP_003223418.1 integrase Not tested LEE Protein 1e-62 42
int-phe AAL60261.1 Int-phe Not tested LEE Protein 8e-63 42
ECO26_5300 YP_003232178.1 integrase Not tested LEE Protein 1e-62 42
Z4313 NP_289539.1 pathogenicity island integrase Not tested OI-122 Protein 5e-62 42
int CAC81896.1 integrase Not tested LEE II Protein 6e-55 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DVU1527 YP_010746.1 phage integrase site specific recombinase VFG0626 Protein 3e-64 43
DVU1527 YP_010746.1 phage integrase site specific recombinase VFG1693 Protein 8e-64 43
DVU1527 YP_010746.1 phage integrase site specific recombinase VFG0783 Protein 7e-80 42
DVU1527 YP_010746.1 phage integrase site specific recombinase VFG0598 Protein 2e-79 42