Gene Information

Name : DET1058 (DET1058)
Accession : YP_181773.1
Strain : Dehalococcoides ethenogenes 195
Genome accession: NC_002936
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 958881 - 959564 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence :
ATGTCTAAGAAAATACTGATAGCCGATGATGAGAATAAAATAGCCGAAATCCTTAAAGCCTATCTTGAACGCGAAGGCTT
TAAGGTGAGCGTTACCTATAATGGCAAAGAGGCCCTGGCAAAATTCCGTGAAGAGAACCCCGACCTGATAATACTTGACC
TGATGCTGCCCGAAATATCCGGCTGGGATGTCTGCCGCGAAATCCGCAAGGAAAGCCGCGTGCCTATAATCATGCTTACC
GCCCGGGATGAACTTACCGACAAGCTGATAGGGCTGGAAATAGGGGCGGATGACTATATGACCAAACCCTTTGAGGCTAA
AGAACTGGTAGCCCGCGCCAAAGTCCAGCTGAGGCGGTCTGAACACACCCCTGCTTCCGAGCCGGTACTGGTTATTGACC
GCCTGGAAATAGATACGGAACGGCGTTTGGTAAAAATGGACGGGGAGAATATAGACCTGACCGCTACCGAATTTGATATA
CTGGCAAATCTGGCCGCAAGCCCGGGGCGGGTTTTCTCCCGTATGCAAATACTGGACAAACTGGGTGAGGCTTACGAAGG
CTATGAACGCACTATAGACAGCCACATTAAAAATCTGCGTAAAAAAATAGAGCCCGACCCCGAATCCCCAGCCTATATCC
TGACCGTACACGGGGTAGGTTACAAGATGAAAGACAAAGGGTAA

Protein sequence :
MSKKILIADDENKIAEILKAYLEREGFKVSVTYNGKEALAKFREENPDLIILDLMLPEISGWDVCREIRKESRVPIIMLT
ARDELTDKLIGLEIGADDYMTKPFEAKELVARAKVQLRRSEHTPASEPVLVIDRLEIDTERRLVKMDGENIDLTATEFDI
LANLAASPGRVFSRMQILDKLGEAYEGYERTIDSHIKNLRKKIEPDPESPAYILTVHGVGYKMKDKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DET1058 YP_181773.1 DNA-binding response regulator NC_012469.1.7685629. Protein 1e-46 49
DET1058 YP_181773.1 DNA-binding response regulator AE000516.2.gene3505. Protein 3e-40 48
DET1058 YP_181773.1 DNA-binding response regulator NC_003923.1003749.p0 Protein 5e-41 45
DET1058 YP_181773.1 DNA-binding response regulator HE999704.1.gene2815. Protein 7e-39 45
DET1058 YP_181773.1 DNA-binding response regulator NC_005054.2598277.p0 Protein 1e-36 44
DET1058 YP_181773.1 DNA-binding response regulator NC_014475.1.orf0.gen Protein 1e-36 44
DET1058 YP_181773.1 DNA-binding response regulator NC_002952.2859905.p0 Protein 5e-41 44
DET1058 YP_181773.1 DNA-binding response regulator FJ349556.1.orf0.gene Protein 2e-36 44
DET1058 YP_181773.1 DNA-binding response regulator NC_002758.1121668.p0 Protein 6e-41 44
DET1058 YP_181773.1 DNA-binding response regulator NC_009641.5332272.p0 Protein 6e-41 44
DET1058 YP_181773.1 DNA-binding response regulator NC_013450.8614421.p0 Protein 6e-41 44
DET1058 YP_181773.1 DNA-binding response regulator NC_007793.3914279.p0 Protein 6e-41 44
DET1058 YP_181773.1 DNA-binding response regulator NC_007622.3794472.p0 Protein 5e-41 44
DET1058 YP_181773.1 DNA-binding response regulator NC_002745.1124361.p0 Protein 6e-41 44
DET1058 YP_181773.1 DNA-binding response regulator NC_009782.5559369.p0 Protein 6e-41 44
DET1058 YP_181773.1 DNA-binding response regulator NC_002951.3237708.p0 Protein 6e-41 44
DET1058 YP_181773.1 DNA-binding response regulator CP000034.1.gene2186. Protein 2e-42 44
DET1058 YP_181773.1 DNA-binding response regulator NC_002695.1.916589.p Protein 2e-42 44
DET1058 YP_181773.1 DNA-binding response regulator BAC0039 Protein 2e-42 44
DET1058 YP_181773.1 DNA-binding response regulator CP001918.1.gene3444. Protein 8e-42 44
DET1058 YP_181773.1 DNA-binding response regulator BAC0596 Protein 1e-41 44
DET1058 YP_181773.1 DNA-binding response regulator CP001138.1.gene2239. Protein 1e-41 44
DET1058 YP_181773.1 DNA-binding response regulator AM180355.1.gene1830. Protein 9e-37 43
DET1058 YP_181773.1 DNA-binding response regulator AF155139.2.orf0.gene Protein 5e-37 43
DET1058 YP_181773.1 DNA-binding response regulator CP000647.1.gene2531. Protein 5e-42 43
DET1058 YP_181773.1 DNA-binding response regulator CP000675.2.gene1535. Protein 2e-44 42
DET1058 YP_181773.1 DNA-binding response regulator NC_011595.7057856.p0 Protein 4e-40 42
DET1058 YP_181773.1 DNA-binding response regulator NC_010410.6002989.p0 Protein 4e-40 42
DET1058 YP_181773.1 DNA-binding response regulator NC_010400.5986590.p0 Protein 3e-39 42
DET1058 YP_181773.1 DNA-binding response regulator CP004022.1.gene1676. Protein 3e-36 42
DET1058 YP_181773.1 DNA-binding response regulator AE015929.1.gene1106. Protein 2e-27 41
DET1058 YP_181773.1 DNA-binding response regulator DQ212986.1.gene4.p01 Protein 8e-36 41
DET1058 YP_181773.1 DNA-binding response regulator BAC0533 Protein 1e-31 41
DET1058 YP_181773.1 DNA-binding response regulator CP000647.1.gene4257. Protein 1e-31 41
DET1058 YP_181773.1 DNA-binding response regulator AF162694.1.orf4.gene Protein 5e-32 41
DET1058 YP_181773.1 DNA-binding response regulator CP001918.1.gene5135. Protein 3e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DET1058 YP_181773.1 DNA-binding response regulator VFG1702 Protein 2e-35 41