Gene Information

Name : arsC (BP1306)
Accession : NP_880072.1
Strain : Bordetella pertussis Tohama I
Genome accession: NC_002929
Putative virulence/resistance : Resistance
Product : arsenate reductase
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1393
EC number : 1.20.4.1
Position : 1375615 - 1375980 bp
Length : 366 bp
Strand : +
Note : Similar to Escherichia coli arsenate reductase ArsC or ArsG or B3503 SW:ARSC_ECOLI (P37311) (141 aa) fasta scores: E(): 9.4e-21, 57.52% id in 113 aa, and to Rhizobium meliloti hypothetical arsenate reductase TR:CAC45654 (EMBL:AL591786) (140 aa) fasta scor

DNA sequence : 
ATGTTCCACCGAGGAGTCTGCATGTCTGCCACCATCTACCACAACCCGCGTTGCAGCACGTCGCGCAACGTGCTGCAAAT
GCTGCGCGACGCGGGCATCGAGCCCACCATCATCGAATACCTGAAGACGCCGCCGTCGCGCCAGACGCTGGCCGGCCTGA
TCCAGCAGTCCGGGCTGAGCGTGCGCGAGGCGGTGCGCGCCAAGGAGCCGATCTACCAGGAACTGGGCCTGGACGGCGTG
GACGACGAGGGCCTGCTCGATGCCATGGTCGACAACCCCATCCTGATCAACCGGCCTTTCGTCATCACCGAGCGGGGCGC
GCGCCTGTGCCGCCCGGCCGAGAGCGTGCGCGAAATCCTGCCGTAG

Protein sequence : 
MFHRGVCMSATIYHNPRCSTSRNVLQMLRDAGIEPTIIEYLKTPPSRQTLAGLIQQSGLSVREAVRAKEPIYQELGLDGV
DDEGLLDAMVDNPILINRPFVITERGARLCRPAESVREILP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 1e-21 54
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 4e-20 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
arsC NP_880072.1 arsenate reductase BAC0583 Protein 4e-22 53
arsC NP_880072.1 arsenate reductase BAC0584 Protein 1e-21 52
arsC NP_880072.1 arsenate reductase BAC0582 Protein 6e-21 51
arsC NP_880072.1 arsenate reductase BAC0585 Protein 4e-21 50