Gene Information

Name : ureB (BPP3856)
Accession : NP_886008.1
Strain : Bordetella parapertussis 12822
Genome accession: NC_002928
Putative virulence/resistance : Virulence
Product : urease subunit beta
Function : -
COG functional category : E : Amino acid transport and metabolism
COG ID : COG0832
EC number : 3.5.1.5
Position : 4176061 - 4176369 bp
Length : 309 bp
Strand : -
Note : ureases catalyze the hydrolysis of urea into ammonia and carbon dioxide; in Helicobacter pylori and Yersinia enterocolitica the ammonia released plays a key role in bacterial survival by neutralizing acids when colonizing the gastric mucosa; the holoenzym

DNA sequence :
ATGATTCCGGGAGAAATACTGACCGAACCGGGCCAGATCGAGCTCAACGTGGGCCGGCCGACCTTGACGATCGCCGTGGT
CAACGAGGGCGACCGGCCGATCCAGGTGGGTTCGCACTATCACTTCGCCGAGGCGAACAACGCCCTGGTCTTCGACCGCG
AGCTGGCAACCGGCTACCGGCTGAACATTCCGGCCGGCAACGCGGTGCGTTTCGAGCCGGGCATGCGCCGCACCGTCGAG
CTGGTGGCGGTCGGCGGCGAGCGCCGCATTTTCGGTTTCCAGGGCAAGGTGATGGGGGCGCTGAAATGA

Protein sequence :
MIPGEILTEPGQIELNVGRPTLTIAVVNEGDRPIQVGSHYHFAEANNALVFDRELATGYRLNIPAGNAVRFEPGMRRTVE
LVAVGGERRIFGFQGKVMGALK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ureB NP_286679.1 urease subunit beta Virulence TAI Protein 3e-27 68
ureB NP_287087.1 urease subunit beta Not tested TAI Protein 3e-27 68
ureB YP_005686359.1 Urease beta subunit Not tested PiCp 7 Protein 9e-24 59
ureB YP_003784326.1 urease subunit beta Not tested PiCp 7 Protein 1e-23 59
ureB YP_005682175.1 Urease beta subunit Not tested PiCp 7 Protein 9e-24 59
ureB YP_005684267.1 Urease beta subunit Not tested PiCp 7 Protein 9e-24 59