Gene Information

Name : bscR (BPP2235)
Accession : NP_884486.1
Strain : Bordetella parapertussis 12822
Genome accession: NC_002928
Putative virulence/resistance : Virulence
Product : type III secretion system protein
Function : -
COG functional category : U : Intracellular trafficking, secretion and vesicular transport
COG ID : COG4790
EC number : -
Position : 2379323 - 2379994 bp
Length : 672 bp
Strand : +
Note : part of a set of proteins involved in the infection of eukaryotic cells; in plant pathogens involved in the hypersensitivity response

DNA sequence :
ATGAGCGATACCGACCCCTTCAGCCTGGCCCTTTTTCTGGCGCTGCTGGCGCTGGTACCGCTCATCGTCGTCATGACCAC
GTCGTTCCTGAAGATCGCCGTCGTGCTTGCCTTGGTGCGCAACGCCCTGGGAGTGCAACAGGTACCGCCCAACATGGCCC
TGTACGGCCTGGCGCTTATTCTTTCCGCGTATGTGATGGCGCCGGTCGTTCACAGGATAGGCACCGAGGTCCAGGCCTTG
ACCGCGCAAGCCGGGGAGTCCGGCACCGCCGCGCCGATGGCGCTGGACGCCGTGCTTGGCGTGGTCGAGCGAGGAGTGGC
GCCGCTGCGGGCCTTCATGCTGCGCAACAGCCAGCCGGCCCAGCGTGATTTCTTCCTGCGCACAGCGCGTCATCTGTGGG
GCGAGGAGGCATCGCGGGACCTGTCGGAAGACAACTTGCTGGTACTGACGCCCGCATTTCTGGTTTCGGAGCTGACCGCC
GCATTCCAGCTTGGCTTTCTGCTGTACCTGCCGTTCATCATCATCGACCTCATCGTATCGAACATTCTTCTTGCCATGGG
AATGATGATGGTTTCTCCCGTGACGATCTCCATGCCGTTGAAGCTGTTCCTGTTCGTCATGGTGGACGGCTGGACGCGCC
TGATCCAGGGCCTGGTGCTTTCCTATCGGTGA

Protein sequence :
MSDTDPFSLALFLALLALVPLIVVMTTSFLKIAVVLALVRNALGVQQVPPNMALYGLALILSAYVMAPVVHRIGTEVQAL
TAQAGESGTAAPMALDAVLGVVERGVAPLRAFMLRNSQPAQRDFFLRTARHLWGEEASRDLSEDNLLVLTPAFLVSELTA
AFQLGFLLYLPFIIIDLIVSNILLAMGMMMVSPVTISMPLKLFLFVMVDGWTRLIQGLVLSYR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
lscR AAO18040.1 LscR Virulence TTSS locus Protein 8e-51 58
hrcR AAT96262.1 HrcR Virulence S-PAI Protein 6e-44 52
hrcR AAT96303.1 HrcR Virulence S-PAI Protein 6e-44 52
hrcR AAT96343.1 HrcR Virulence S-PAI Protein 6e-44 52
hrcR ABA47279.1 HrcR Virulence S-PAI Protein 5e-44 51
hrcR AAT96200.1 HrcR Virulence T-PAI Protein 1e-37 51
hrcR NP_791222.3 type III secretion protein HrcR Virulence Hrp PAI Protein 5e-38 50
hrcR AAG33884.1 HrcR Virulence Hrp PAI Protein 4e-38 50
YPO0270 YP_002345352.1 type III secretion system protein Virulence Not named Protein 9e-41 50
hrcR AAT96146.1 HrcR Virulence T-PAI Protein 1e-37 50
hrcR ABQ88359.1 HrcR Virulence Hrp PAI Protein 1e-36 49
hrpW AAB05075.1 HrpW Virulence Hrp PAI Protein 1e-36 49
hrcR AAB06005.2 HrcR Virulence Hrp PAI Protein 3e-42 49
hrcR AAP34349.1 HrcR Virulence Hrp PAI Protein 2e-44 48
XC_3016 YP_244084.1 type III secretion system protein Virulence Hrp PAI Protein 6e-44 48
hrcR NP_636600.1 type III secretion system protein Virulence Hrp PAI Protein 6e-44 48
hrcR NP_640757.1 type III secretion system protein Virulence Hrp PAI Protein 3e-44 48
hrcR YP_362153.1 type III secretion system protein Virulence Hrp PAI Protein 3e-44 48
hrcR AAD21321.1 HrcR Virulence Hrp PAI Protein 2e-44 48
hrcR BAB07862.1 HrcR Virulence Hrp PAI Protein 3e-44 47
hrcR YP_198720.1 type III secretion system protein Virulence Hrp PAI Protein 3e-44 47
yscR NP_805090.1 type III secretion system protein Virulence SPI-2 Protein 2e-38 46
ssaR CAA68199.1 secretion system apparatus, SsaR Virulence SPI-2 Protein 5e-39 46
ssaR YP_216427.1 type III secretion system protein Virulence SPI-2 Protein 8e-39 46
ssaR NP_460384.1 type III secretion system protein Virulence SPI-2 Protein 8e-39 46
yscR NP_456109.1 putative type III secretion protein Virulence SPI-2 Protein 2e-38 46
escR ACU09473.1 type III secretion system protein EscR Virulence LEE Protein 5e-40 46
escR AAC38369.1 EscR Virulence LEE Protein 5e-39 46
unnamed AAL06354.1 EscR Virulence LEE Protein 3e-39 46
ECs4583 NP_312610.1 type III secretion system protein Virulence LEE Protein 8e-40 46
escR AAC31528.1 L0049 Virulence LEE Protein 5e-40 46
escR YP_003223490.1 T3SS structure protein EscR Virulence LEE Protein 7e-40 46
escR AAK26700.1 EscR Virulence LEE Protein 5e-40 46
escR YP_003236103.1 T3SS structure protein EscR Virulence LEE Protein 7e-40 46
escR AAL57527.1 EscR Virulence LEE Protein 5e-40 46
escR NP_290283.1 type III secretion system protein Virulence LEE Protein 7e-40 46
escR CAC81847.1 EscR protein Virulence LEE II Protein 5e-40 46
escR YP_003232138.1 type III secretion system protein Virulence LEE Protein 7e-40 46
escR CAI43889.1 EscR protein Virulence LEE Protein 5e-40 46
escR AFO66317.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 5e-38 45
escR AFO66400.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 5e-38 45
ysaR AAS66846.1 YsaR Not tested SSR-1 Protein 7e-37 42
spaP AAS66865.1 SpaP Not tested SSR-2 Protein 2e-35 42
spaP NP_457284.1 secretory protein (associated with virulence) Virulence SPI-1 Protein 2e-26 41
spaP NP_806493.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 2e-26 41
spaP YP_217809.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 8e-27 41
spaP NP_461811.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 8e-27 41
spaP NP_311752.1 surface presentation of antigens protein SpaP Not tested LIM Protein 3e-36 41
epaP AAZ31293.1 EpaP Virulence ETT2 Protein 1e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bscR NP_884486.1 type III secretion system protein VFG0044 Protein 1e-90 99
bscR NP_884486.1 type III secretion system protein VFG0188 Protein 7e-49 55
bscR NP_884486.1 type III secretion system protein VFG0394 Protein 2e-48 54
bscR NP_884486.1 type III secretion system protein VFG0519 Protein 3e-39 46
bscR NP_884486.1 type III secretion system protein VFG0827 Protein 3e-40 46
bscR NP_884486.1 type III secretion system protein VFG0715 Protein 3e-39 46
bscR NP_884486.1 type III secretion system protein VFG1773 Protein 2e-35 43
bscR NP_884486.1 type III secretion system protein VFG1259 Protein 1e-33 42
bscR NP_884486.1 type III secretion system protein VFG0551 Protein 3e-27 41
bscR NP_884486.1 type III secretion system protein VFG2338 Protein 4e-30 41
bscR NP_884486.1 type III secretion system protein VFG2016 Protein 3e-32 41