
|
Name : BPP1431 (BPP1431) Accession : NP_883731.1 Strain : Bordetella parapertussis 12822 Genome accession: NC_002928 Putative virulence/resistance : Resistance Product : MerR family transcriptional regulator Function : - COG functional category : K : Transcription COG ID : COG0789 EC number : - Position : 1530295 - 1530729 bp Length : 435 bp Strand : + Note : ortholog of Bordetella pertussis (BX470248) BP2723 DNA sequence : ATGAAAATCGGCGAACTGGCCCGCACGGCGGGCACCACGGTGGAAACCGTGCGCTATTACGAGAAGGAAGGGCTGTTGCC CGCGCCCGAGCGCGGCCTGAACAACTACCGCAGCTACGGCGAGGCCCATGTCGAGCGGCTGCGCCTGATCCGCAATTGCC GCGCGCTGGACATGACGCAGGACGAGATCCGCACCGTCCTGGCCCTGGCGGACAACCACGAGGCCGGCTGCGCTCCGATC AACCAGGTGTTCGACGAGCACATCGCCCACGTGGACGCCCGCATCGCCGAGCTGACCCAGCTGAAAGCCCAGCTGGGCGA GCTGCGCCAGCGCTGCGCCTCGGCCCGTCCGGACGCCGAGGACTGCGGCATCCTGCACGGCCTGAGCGAGATGCAGGTCG AAGAGCGTCCCGAGCGCCACACCCACCTCGGCTAG Protein sequence : MKIGELARTAGTTVETVRYYEKEGLLPAPERGLNNYRSYGEAHVERLRLIRNCRALDMTQDEIRTVLALADNHEAGCAPI NQVFDEHIAHVDARIAELTQLKAQLGELRQRCASARPDAEDCGILHGLSEMQVEERPERHTHLG |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| ORF C98 | AAN62191.1 | putative transcriptional regulator | Not tested | PAGI-2(C) | Protein | 3e-29 | 51 |
| ACICU_00234 | YP_001844893.1 | transcriptional regulator | Not tested | AbaR20 | Protein | 6e-29 | 46 |
| pbrR | CAJ77094.1 | Transcriptional regulator | Not tested | AbaR1 | Protein | 4e-29 | 46 |
| cadR | AGK36653.1 | MerR family transcriptional regulator | Not tested | AbaR26 | Protein | 4e-29 | 46 |
| cadR | ACN81029.1 | MerR family transcriptional regulator | Not tested | AbaR5 | Protein | 5e-29 | 46 |
| cadR | ADZ05769.1 | MerR family transcriptional regulator | Not tested | AbaR11 | Protein | 1e-28 | 45 |
| cadR | ACS32041.1 | MerR family transcriptional regulator | Not tested | AbaR5 | Protein | 1e-28 | 45 |
| pbrR | CAJ77021.1 | transcription regulator | Not tested | AbaR1 | Protein | 9e-29 | 45 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| BPP1431 | NP_883731.1 | MerR family transcriptional regulator | BAC0301 | Protein | 6e-29 | 56 |
| BPP1431 | NP_883731.1 | MerR family transcriptional regulator | BAC0058 | Protein | 2e-34 | 52 |