Name : ureB (BB4324) Accession : NP_890858.1 Strain : Bordetella bronchiseptica RB50 Genome accession: NC_002927 Putative virulence/resistance : Virulence Product : urease subunit beta Function : - COG functional category : E : Amino acid transport and metabolism COG ID : COG0832 EC number : 3.5.1.5 Position : 4603936 - 4604244 bp Length : 309 bp Strand : - Note : ureases catalyze the hydrolysis of urea into ammonia and carbon dioxide; in Helicobacter pylori and Yersinia enterocolitica the ammonia released plays a key role in bacterial survival by neutralizing acids when colonizing the gastric mucosa; the holoenzym DNA sequence : ATGATTCCGGGAGAAATACTGACCGAACCGGGCCAGATCGAGCTCAACGTGGGCCGGCCGACCTTGACGATCGCCGTGGT CAACGAGGGCGACCGGCCGATCCAGGTGGGTTCGCACTATCACTTCGCCGAGGCGAACAACGCCCTGGTCTTCGACCGCG AGCTGGCAACCGGCTACCGGCTGAACATTCCGGCCGGCAACGCGGTGCGTTTCGAGCCGGGCATGCGCCGCACCGTCGAG CTGGTGGCGGTCGGCGGCGAGCGCCGCATCTTCGGTTTCCAGGGCAAGGTGATGGGGGCGCTGAAATGA Protein sequence : MIPGEILTEPGQIELNVGRPTLTIAVVNEGDRPIQVGSHYHFAEANNALVFDRELATGYRLNIPAGNAVRFEPGMRRTVE LVAVGGERRIFGFQGKVMGALK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
ureB | NP_286679.1 | urease subunit beta | Virulence | TAI | Protein | 3e-27 | 68 |
ureB | NP_287087.1 | urease subunit beta | Not tested | TAI | Protein | 3e-27 | 68 |
ureB | YP_005682175.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 9e-24 | 59 |
ureB | YP_005684267.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 9e-24 | 59 |
ureB | YP_005686359.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 9e-24 | 59 |
ureB | YP_003784326.1 | urease subunit beta | Not tested | PiCp 7 | Protein | 1e-23 | 59 |