Gene Information

Name : BB2505 (BB2505)
Accession : NP_889044.1
Strain : Bordetella bronchiseptica RB50
Genome accession: NC_002927
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 2658930 - 2659364 bp
Length : 435 bp
Strand : +
Note : ortholog of Bordetella pertussis (BX470248) BP2723

DNA sequence :
ATGAAAATCGGCGAACTGGCCCGCACGGCGGGCACCACGGTGGAAACCGTGCGCTATTACGAGAAGGAAGGGCTGTTGCC
CGCGCCCGAGCGCGGCCTGAACAACTACCGCAGCTACGGCGAGGCCCATGTCGAGCGGCTGCGCCTGATCCGCAATTGCC
GCGCGCTGGACATGACGCAGGACGAGATCCGCACCGTCCTGGCCCTGGCGGACAACCACGAGGCCGGCTGCGCTCCGATC
AACCAGGTGTTCGACGAGCACATCGCCCACGTGGACGCCCGCATCGCCGAGCTGACCCAGCTGAAGGCCCAGCTGGGCGA
GCTGCGCCAGCGCTGCGCCTCGGCCCGCCCAGACGCCGAGGACTGCGGCATCCTGCACGGCCTGAGCGAGATGCAGGTCG
AAGAGCGTCCCGAGCGCCACACCCACCTCGGCTAG

Protein sequence :
MKIGELARTAGTTVETVRYYEKEGLLPAPERGLNNYRSYGEAHVERLRLIRNCRALDMTQDEIRTVLALADNHEAGCAPI
NQVFDEHIAHVDARIAELTQLKAQLGELRQRCASARPDAEDCGILHGLSEMQVEERPERHTHLG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 3e-29 51
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 6e-29 46
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 4e-29 46
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 4e-29 46
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 5e-29 46
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 1e-28 45
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 1e-28 45
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 9e-29 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BB2505 NP_889044.1 MerR family transcriptional regulator BAC0301 Protein 6e-29 56
BB2505 NP_889044.1 MerR family transcriptional regulator BAC0058 Protein 2e-34 52