Gene Information

Name : rpsN (MT2117)
Accession : NP_336582.1
Strain : Mycobacterium tuberculosis CDC1551
Genome accession: NC_002755
Putative virulence/resistance : Unknown
Product : 30S ribosomal protein S14
Function : -
COG functional category : J : Translation, ribosomal structure and biogenesis
COG ID : COG0199
EC number : -
Position : 2316687 - 2316992 bp
Length : 306 bp
Strand : -
Note : located in the peptidyl transferase center and involved in assembly of 30S ribosome subunit; similar to what is observed with proteins L31 and L33, some proteins in this family contain CXXC motifs that are involved in zinc binding; if two copies are prese

DNA sequence :
GTGGCCAAGAAGTCCAAGATCGTCAAGAATCAGCGGCGGGCGGCCACCGTCGCCCGTTACGCATCGCGTCGCACCGCGCT
CAAAGACATCATCCGATCCCCATCGAGCGCCCCCGAACAGCGCAGTACCGCCCAGCGAGCCCTTGCCCGCCAGCCCCGCG
ACGCCAGTCCCGTGCGGTTACGCAACCGCGACGCCATCGACGGCCGGCCGCGCGGACATCTCCGCAAATTCGGGCTCTCC
CGTGTGCGGGTCCGCCAACTGGCCCACGACGGACACCTGCCCGGTGTCCGGAAGGCCAGCTGGTAG

Protein sequence :
MAKKSKIVKNQRRAATVARYASRRTALKDIIRSPSSAPEQRSTAQRALARQPRDASPVRLRNRDAIDGRPRGHLRKFGLS
RVRVRQLAHDGHLPGVRKASW

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ef0103 AAM75306.1 EF0103 Not tested Not named Protein 6e-16 51
rpsN NP_814350.1 30S ribosomal protein S14 Not tested Not named Protein 9e-16 51