Gene Information

Name : ECs4577 (ECs4577)
Accession : NP_312604.1
Strain : Escherichia coli Sakai
Genome accession: NC_002695
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4613767 - 4614180 bp
Length : 414 bp
Strand : -
Note : similar to L0043 [Escherichia coli O157:H7 strain EDL933] gi|3414911|gb|AAC31522.1|, Orf11 [Escherichia coli strain E2348/69] gi|2865282|gb|AAC38375.1|

DNA sequence :
ATGGAATCTAAAAATAAAAATGGCGACTATGTAATTCCTGACTCAGTAAAGAATTACGATGGTGAACCTCTGTATATCTT
GGTTTCTCTTTGGTGTAAATTGCAGGAGAAATGGATTTCTCGCAATGATATTGCCGAAGCATTCGGTATAAACCTGAGGA
GAGCATCATTTATTATAACTTATATATCGAGAAGAAAAGAAAAAATTTCATTTCGTGTCAGATATGTTAGTTATGGTAAT
TTGCATTATAAGCGCCTTGAGATTTTCATTTATGATGTTAACCTTGAGGCGGTTCCGATAGAAAGTCCTGGAACAACCGG
ACCAAAAAGAAAAACCTACCGAGTTGGTAATGGTATTGTGGGACAGTCTAATATCTGGAACGAAATGATCATGAGGCGGA
AAAAGGAGAGTTAG

Protein sequence :
MESKNKNGDYVIPDSVKNYDGEPLYILVSLWCKLQEKWISRNDIAEAFGINLRRASFIITYISRRKEKISFRVRYVSYGN
LHYKRLEIFIYDVNLEAVPIESPGTTGPKRKTYRVGNGIVGQSNIWNEMIMRRKKES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACU09467.1 regulatory protein GrlA Virulence LEE Protein 7e-60 100
Z5128 NP_290277.1 hypothetical protein Not tested LEE Protein 9e-60 100
ECs4577 NP_312604.1 hypothetical protein Not tested LEE Protein 9e-60 100
unnamed AAC31522.1 L0043 Not tested LEE Protein 7e-60 100
grlA YP_003236097.1 positive regulator GrlA Not tested LEE Protein 3e-59 99
unnamed AAC38375.1 Orf11 Not tested LEE Protein 2e-59 99
grlA YP_003223484.1 positive regulator GrlA Not tested LEE Protein 1e-58 98
unnamed CAI43883.1 hypothetical protein Not tested LEE Protein 4e-58 98
grlA YP_003232144.1 positive regulator GrlA Not tested LEE Protein 3e-58 97
unnamed AAK26706.1 unknown Not tested LEE Protein 2e-58 97
unnamed AAL57533.1 unknown Not tested LEE Protein 1e-57 97
st15 CAC81853.1 ST15 protein Not tested LEE II Protein 1e-57 97
unnamed AAL06360.1 unknown Not tested LEE Protein 2e-54 92
grlA AFO66406.1 putative LEE-encoded positive regulator of transcription Virulence SESS LEE Protein 2e-39 63
grlA AFO66330.1 putative LEE-encoded positive regulator of transcription Not tested SESS LEE Protein 2e-39 63

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECs4577 NP_312604.1 hypothetical protein VFG0821 Protein 3e-60 100
ECs4577 NP_312604.1 hypothetical protein VFG0721 Protein 8e-60 99