Gene Information

Name : ECs4552 (ECs4552)
Accession : NP_312579.1
Strain : Escherichia coli Sakai
Genome accession: NC_002695
Putative virulence/resistance : Virulence
Product : protein EscF
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4590372 - 4590593 bp
Length : 222 bp
Strand : -
Note : similar to EscF [Escherichia coli] gi|2865306|gb|AAC38398.1|, L0018 [Escherichia coli EDL933] gi|3414886|gb|AAC31497.1|

DNA sequence :
ATGAATTTATCTGAAATTACTCAACAAATGGGTGAAGTAGGTAAAACGCTGAGCGATTCTGTGCCAGAGTTACTTAATAG
CACCGATTTGGTTAATGACCCTGAAAAAATGTTAGAGTTGCAGTTTGCGGTTCAGCAATATTCTGCTTATGTTAACGTAG
AAAGTGGAATGTTGAAAACGATAAAAGATCTGGTCTCAACCATTTCTAACCGTAGTTTTTAA

Protein sequence :
MNLSEITQQMGEVGKTLSDSVPELLNSTDLVNDPEKMLELQFAVQQYSAYVNVESGMLKTIKDLVSTISNRSF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
escF CAC81878.1 EscF protein Virulence LEE II Protein 5e-28 100
escF CAI43858.1 EscF protein Virulence LEE Protein 5e-28 100
eprI ACU09442.1 type III secretion apparatus needle protein EprI Virulence LEE Protein 5e-28 100
escF AAC38398.1 EscF Virulence LEE Protein 5e-28 100
escF YP_003223459.1 T3SS structure protein EscF Virulence LEE Protein 8e-28 100
escF AAC31497.1 L0018 Virulence LEE Protein 5e-28 100
escF YP_003236072.1 T3SS structure protein EscF Virulence LEE Protein 8e-28 100
escF AAK26731.1 EscF Virulence LEE Protein 5e-28 100
escF NP_290252.1 hypothetical protein Virulence LEE Protein 8e-28 100
escF AAL57558.1 EscF Virulence LEE Protein 5e-28 100
ECs4552 NP_312579.1 protein EscF Virulence LEE Protein 8e-28 100
escF AAL60254.1 EscF Virulence LEE Protein 5e-28 100
escF YP_003232169.1 T3SS structure protein EscF Virulence LEE Protein 8e-28 100
escF AFO66347.1 putative LEE-encoded type III secretion system structural component Not tested SESS LEE Protein 2e-26 88
escF AFO66385.1 putative LEE-encoded type III secretion system structural component Virulence SESS LEE Protein 2e-26 88
unnamed AAL06385.1 EscF Virulence LEE Protein 3e-21 60

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECs4552 NP_312579.1 protein EscF VFG0796 Protein 2e-28 100
ECs4552 NP_312579.1 protein EscF VFG0746 Protein 2e-28 100