Gene Information

Name : ECs4541 (ECs4541)
Accession : NP_312568.1
Strain : Escherichia coli Sakai
Genome accession: NC_002695
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4584680 - 4584877 bp
Length : 198 bp
Strand : +
Note : similar to L0009 [Escherichia coli strain EDL933] gi|3414877|gb|AAC31488.1|, hypothetical protein [Escherichia coli D1114, O25:K10:H16] gi|4887094|gb|AAD32187.1

DNA sequence :
ATGACATCATTAACCCCGGAAGCAGCACTGGATATTCTGATTGCGTGGCTGCAGGACAATATCGACAGCGAATCCGGAAT
TATCTTCGACAACGATGAGGATAAAACGGATTCGGCAGCATTGTTGCCCTGTATCGAACAGGTCAGGGAAGATGTCCGTA
CCCTGCGCCAACTGCAGCTTCTGCAACAGAACCGGTGA

Protein sequence :
MTSLTPEAALDILIAWLQDNIDSESGIIFDNDEDKTDSAALLPCIEQVREDVRTLRQLQLLQQNR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAC31488.1 L0009 Not tested LEE Protein 3e-18 100
unnamed ACU09435.1 conserved hypothetical protein Not tested LEE Protein 3e-18 100
Z5093 NP_290244.1 hypothetical protein Not tested LEE Protein 4e-18 100
ECs4541 NP_312568.1 hypothetical protein Not tested LEE Protein 4e-18 100
ECO111_3780 YP_003236115.1 hypothetical protein Not tested LEE Protein 3e-16 91
Z1225 NP_286759.1 hypothetical protein Not tested TAI Protein 5e-16 89
ECO103_3594 YP_003223451.1 hypothetical protein Not tested LEE Protein 3e-16 89
unnamed AAL08480.1 unknown Not tested SRL Protein 4e-16 89
unnamed AAK00484.1 unknown Not tested SHI-1 Protein 1e-15 88
unnamed AAL67387.1 L0009-like protein Not tested PAI II CFT073 Protein 7e-16 88
SF3001 NP_708775.1 hypothetical protein Not tested SHI-1 Protein 2e-15 88
c5147 NP_756995.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-15 88

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECs4541 NP_312568.1 hypothetical protein VFG0788 Protein 1e-18 100
ECs4541 NP_312568.1 hypothetical protein VFG1071 Protein 2e-16 89
ECs4541 NP_312568.1 hypothetical protein VFG0665 Protein 5e-16 88