|
Name : ECs4541 (ECs4541) Accession : NP_312568.1 Strain : Escherichia coli Sakai Genome accession: NC_002695 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 4584680 - 4584877 bp Length : 198 bp Strand : + Note : similar to L0009 [Escherichia coli strain EDL933] gi|3414877|gb|AAC31488.1|, hypothetical protein [Escherichia coli D1114, O25:K10:H16] gi|4887094|gb|AAD32187.1 DNA sequence : ATGACATCATTAACCCCGGAAGCAGCACTGGATATTCTGATTGCGTGGCTGCAGGACAATATCGACAGCGAATCCGGAAT TATCTTCGACAACGATGAGGATAAAACGGATTCGGCAGCATTGTTGCCCTGTATCGAACAGGTCAGGGAAGATGTCCGTA CCCTGCGCCAACTGCAGCTTCTGCAACAGAACCGGTGA Protein sequence : MTSLTPEAALDILIAWLQDNIDSESGIIFDNDEDKTDSAALLPCIEQVREDVRTLRQLQLLQQNR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | AAC31488.1 | L0009 | Not tested | LEE | Protein | 3e-18 | 100 |
| unnamed | ACU09435.1 | conserved hypothetical protein | Not tested | LEE | Protein | 3e-18 | 100 |
| Z5093 | NP_290244.1 | hypothetical protein | Not tested | LEE | Protein | 4e-18 | 100 |
| ECs4541 | NP_312568.1 | hypothetical protein | Not tested | LEE | Protein | 4e-18 | 100 |
| ECO111_3780 | YP_003236115.1 | hypothetical protein | Not tested | LEE | Protein | 3e-16 | 91 |
| unnamed | AAL08480.1 | unknown | Not tested | SRL | Protein | 4e-16 | 89 |
| Z1225 | NP_286759.1 | hypothetical protein | Not tested | TAI | Protein | 5e-16 | 89 |
| ECO103_3594 | YP_003223451.1 | hypothetical protein | Not tested | LEE | Protein | 3e-16 | 89 |
| unnamed | AAK00484.1 | unknown | Not tested | SHI-1 | Protein | 1e-15 | 88 |
| unnamed | AAL67387.1 | L0009-like protein | Not tested | PAI II CFT073 | Protein | 7e-16 | 88 |
| SF3001 | NP_708775.1 | hypothetical protein | Not tested | SHI-1 | Protein | 2e-15 | 88 |
| c5147 | NP_756995.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 1e-15 | 88 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| ECs4541 | NP_312568.1 | hypothetical protein | VFG0788 | Protein | 1e-18 | 100 |
| ECs4541 | NP_312568.1 | hypothetical protein | VFG1071 | Protein | 2e-16 | 89 |
| ECs4541 | NP_312568.1 | hypothetical protein | VFG0665 | Protein | 5e-16 | 88 |
