Gene Information

Name : ECs4539 (ECs4539)
Accession : NP_312566.1
Strain : Escherichia coli Sakai
Genome accession: NC_002695
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4583806 - 4584180 bp
Length : 375 bp
Strand : +
Note : similar to L0007 [Escherichia coli EDL933] gi|3414875|gb|AAC31486.1|, hypothetical proteins e.g. b2005 (yeeV) [Escherichia coli] gi|3025158|sp|P76365|YEEV_ECOLI

DNA sequence :
ATGAAAACATTACCCGATACACACGTACGGGAGGCATCGCGCTGCCCGTCTCCCATCACCATCTGGCAGACACTGCTTGG
CCGTCTGCTGGACCAGCACTACGGCCTCACGCTGAATGACACACCGTTCGCTGATGAACGTGTGATTGAGCAGCATATTG
AGGCAGGTATTTCACTGTGTGATGCGGTGAACTTTCTCGTGGAAAAATACGTGCTGGTGCGTACCGACCAGCCGGGATTC
AGCGCCTGTACCCGCTCTCAGTTAATAAACAGCATCGATATCCTCCGGGCTCGCAGGGCGACCGGCCTGATGACCCGCGA
CAATTACAGAACGGTAAATAACATTACCCTGGGTAAGCATCCGGAGGCGAAATGA

Protein sequence :
MKTLPDTHVREASRCPSPITIWQTLLGRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 8e-55 100
unnamed AAC31486.1 L0007 Not tested LEE Protein 5e-55 100
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 8e-55 100
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 5e-55 100
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 5e-52 96
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 3e-52 95
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 9e-53 95
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 1e-51 95
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-52 95
unnamed AAL57575.1 unknown Not tested LEE Protein 7e-52 95
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 4e-50 94
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 2e-51 94
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 5e-50 94
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 5e-50 94
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 3e-52 93
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 3e-52 93
unnamed AAL08478.1 unknown Not tested SRL Protein 2e-51 93
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 4e-52 93
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 2e-50 92
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 1e-49 92
yeeV AAZ04461.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 1e-48 92
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 2e-49 91

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECs4539 NP_312566.1 hypothetical protein VFG0786 Protein 2e-55 100
ECs4539 NP_312566.1 hypothetical protein VFG1530 Protein 2e-52 96
ECs4539 NP_312566.1 hypothetical protein VFG1682 Protein 6e-52 95
ECs4539 NP_312566.1 hypothetical protein VFG0663 Protein 2e-50 94
ECs4539 NP_312566.1 hypothetical protein VFG1069 Protein 8e-52 93
ECs4539 NP_312566.1 hypothetical protein VFG1620 Protein 2e-52 93