Gene Information

Name : ECs3871 (ECs3871)
Accession : NP_311898.1
Strain : Escherichia coli Sakai
Genome accession: NC_002695
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 3875222 - 3875566 bp
Length : 345 bp
Strand : +
Note : similar to hypothetical proteins e.g. L0004 [Escherichia coli O157:H7 strain EDL933] gi|3414872|gb|AAC31483.1|, transposase [Vibrio cholerae] gi|7960026|gb|AAF71186.1|AF179596_6

DNA sequence :
ATGAACAAGAAAACCAAACGTACTTTCACCCCTGAATTCAGGCTGGAATGTGCACAGCTAATTGTTGATAAGGGCTACTC
ATATCGACAAGCCAGTGAAGCGATGAATGTCGGTTCTACCACGCTTGAGAGTTGGGTGCGCCAGCTCAGGCGAGAGCGTC
AGGGGATTGCGCCCTCTGCCACACCTATTACTCCAGACCAGCAACGTATCCGCGAACTGGAAAAGCAGGTTCGCCGCCTG
GAGGAACACAATACGATATTAAAAAAGGCTTCTCACCGATGGTCATCGCAACACGACGCCAGCCAATCATGGTGCCAATG
CCGAGCGCCAGTGCTACTGCCATGA

Protein sequence :
MNKKTKRTFTPEFRLECAQLIVDKGYSYRQASEAMNVGSTTLESWVRQLRRERQGIAPSATPITPDQQRIRELEKQVRRL
EEHNTILKKASHRWSSQHDASQSWCQCRAPVLLP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 2e-38 99
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 1e-38 99
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 1e-38 99
unnamed AAC31483.1 L0004 Not tested LEE Protein 7e-39 99
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 6e-38 97
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 4e-38 97
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-25 60
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 7e-25 60
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-25 60
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-25 60
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-24 60
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-25 60
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-24 60
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-25 60
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 3e-19 55
api80 CAF28554.1 putative transposase Not tested YAPI Protein 3e-19 54
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-19 54
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-19 54
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-19 53
tnpA CAB61575.1 transposase A Not tested HPI Protein 7e-19 52
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-17 47
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 6e-18 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECs3871 NP_311898.1 hypothetical protein VFG0784 Protein 3e-39 99
ECs3871 NP_311898.1 hypothetical protein VFG1123 Protein 3e-25 60
ECs3871 NP_311898.1 hypothetical protein VFG1485 Protein 6e-20 54
ECs3871 NP_311898.1 hypothetical protein VFG1553 Protein 3e-18 46