Name : ECs3513 (ECs3513) Accession : NP_311540.1 Strain : Escherichia coli Sakai Genome accession: NC_002695 Putative virulence/resistance : Virulence Product : DNA binding protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 3498740 - 3498946 bp Length : 207 bp Strand : - Note : similar to Bacteriophage P4 DNA-binding protein P12552 and Yersinia pestis hypothetical protein T17447 DNA sequence : ATGAATCAGCACAACACCCGCCTTATTCGTTTACCAGAGGTTCTGCATCGAACTGGATACGGTAAAGCTTGGATCTATCA CCTCATCAACCAAAATCGTTTTCCTTCCCCCGTTAAAATCGGTGCGCGCTCTGTTGCTTTCATTGAAAGTGAAGTAGACG AATGGATTCAATTAACTATCGAAAATTCAAGAAAGCATGTTGCCTGA Protein sequence : MNQHNTRLIRLPEVLHRTGYGKAWIYHLINQNRFPSPVKIGARSVAFIESEVDEWIQLTIENSRKHVA |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 1e-10 | 47 |
VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-10 | 46 |
VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-10 | 46 |
PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 3e-05 | 43 |
unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 3e-06 | 42 |
unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 5e-06 | 42 |
VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 4e-06 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
ECs3513 | NP_311540.1 | DNA binding protein | VFG1141 | Protein | 6e-11 | 46 |