Gene Information

Name : ECs3513 (ECs3513)
Accession : NP_311540.1
Strain : Escherichia coli Sakai
Genome accession: NC_002695
Putative virulence/resistance : Virulence
Product : DNA binding protein
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 3498740 - 3498946 bp
Length : 207 bp
Strand : -
Note : similar to Bacteriophage P4 DNA-binding protein P12552 and Yersinia pestis hypothetical protein T17447

DNA sequence :
ATGAATCAGCACAACACCCGCCTTATTCGTTTACCAGAGGTTCTGCATCGAACTGGATACGGTAAAGCTTGGATCTATCA
CCTCATCAACCAAAATCGTTTTCCTTCCCCCGTTAAAATCGGTGCGCGCTCTGTTGCTTTCATTGAAAGTGAAGTAGACG
AATGGATTCAATTAACTATCGAAAATTCAAGAAAGCATGTTGCCTGA

Protein sequence :
MNQHNTRLIRLPEVLHRTGYGKAWIYHLINQNRFPSPVKIGARSVAFIESEVDEWIQLTIENSRKHVA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 1e-10 47
VC1809 NP_231443.1 transcriptional regulator Not tested VPI-2 Protein 2e-10 46
VC0395_A1406 YP_001217349.1 transcriptional regulator Not tested VPI-2 Protein 2e-10 46
PMI2608 YP_002152324.1 prophage regulatory protein Not tested Not named Protein 3e-05 43
unnamed CAA21398.1 - Not tested HPI Protein 5e-06 42
unnamed CAB46594.1 DNA-binding protein Not tested HPI Protein 3e-06 42
VC0497 NP_230151.1 transcriptional regulator Not tested VSP-2 Protein 4e-06 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECs3513 NP_311540.1 DNA binding protein VFG1141 Protein 6e-11 46