Gene Information

Name : ECs1659 (ECs1659)
Accession : NP_309686.1
Strain : Escherichia coli Sakai
Genome accession: NC_002695
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 1657268 - 1657615 bp
Length : 348 bp
Strand : +
Note : similar to hypothetical proteins e.g. L0014 [Escherichia coli O157:H7 EDL933] gi|3414882|gb|AAC31493.1

DNA sequence :
ATGATCCCGTTACCTTCCGGGACCAAAATTTGGCTGGTTGCCGGTATCACCGATATGAGAAATGGCTTCAACGGCCTGGC
TGCGAAAGTACAAACGGCGCTGAAAGACGATCCCATGTCCGGCCATGTTTTCATTTTCCGGGGCCGCAGCGGCAGTCAGG
TTAAACTGCTGTGGTCCACCGGTGACGGACTGTGCCTCCTGACCAAACGGCTGGAGCGTGGGCGCTTCGCCTGGCCGTCA
GCCCGTGATGGCAAAGTGTTCCTTACGCAGGCGCAGCTGGCGATGCTGCTGGAAGGTATCGACTGGCGACAGCCTAAGCG
GCTGCTGACCTCCCTGACCATGCTGTAA

Protein sequence :
MIPLPSGTKIWLVAGITDMRNGFNGLAAKVQTALKDDPMSGHVFIFRGRSGSQVKLLWSTGDGLCLLTKRLERGRFAWPS
ARDGKVFLTQAQLAMLLEGIDWRQPKRLLTSLTML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-49 100
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-49 100
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-49 100
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-49 100
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-49 100
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-49 100
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-49 100
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-49 100
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 3e-36 99
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 3e-48 99
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 3e-48 99
unnamed AAL08461.1 unknown Not tested SRL Protein 6e-49 99
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-48 98
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-48 98
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 3e-39 76
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 3e-39 76
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 7e-39 75
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 8e-37 72
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 8e-37 72
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 3e-29 68
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-34 66
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-34 66
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-35 65
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-35 65
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-35 64

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECs1659 NP_309686.1 hypothetical protein VFG1709 Protein 1e-49 100
ECs1659 NP_309686.1 hypothetical protein VFG0792 Protein 1e-49 100
ECs1659 NP_309686.1 hypothetical protein VFG1517 Protein 1e-36 99
ECs1659 NP_309686.1 hypothetical protein VFG1052 Protein 3e-49 99
ECs1659 NP_309686.1 hypothetical protein VFG1698 Protein 6e-49 98
ECs1659 NP_309686.1 hypothetical protein VFG1665 Protein 3e-39 75
ECs1659 NP_309686.1 hypothetical protein VFG1737 Protein 1e-35 64