Name : ECs1575 (ECs1575) Accession : NP_309602.1 Strain : Escherichia coli Sakai Genome accession: NC_002695 Putative virulence/resistance : Virulence Product : DNA binding protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 1596345 - 1596533 bp Length : 189 bp Strand : + Note : similar to DNA binding protein (ORF88) [Bacteriophage P4] gi|140147|sp|P12552|Y9K_BPP4 DNA sequence : GTGTTAAGCACTGATCGGTTTATACGTGAAAAAGAATGCGAAAAACTAACCGGCCTTAGCCGTACGTGTCGCTACCGCCT GGAAAAGGCCGGACAATTCCCATCACGTCGTAAACTTGGCGGTCGTTCCGTTGGCTGGTCTTTATCCGAGGTTCTGGCCT GGAAGGATAGCTGCAAGGCAGTTCATTAA Protein sequence : MLSTDRFIREKECEKLTGLSRTCRYRLEKAGQFPSRRKLGGRSVGWSLSEVLAWKDSCKAVH |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-06 | 44 |
VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-06 | 44 |
VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-06 | 44 |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 0.068 | 42 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 0.11 | 42 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 0.11 | 42 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 0.078 | 42 |
VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 2e-06 | 42 |
ORF SG104 | AAN62325.1 | phage-related protein | Not tested | PAGI-3(SG) | Protein | 4e-05 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
ECs1575 | NP_309602.1 | DNA binding protein | VFG1118 | Protein | 9e-07 | 44 |
ECs1575 | NP_309602.1 | DNA binding protein | VFG0651 | Protein | 0.032 | 42 |