Gene Information

Name : ECs1575 (ECs1575)
Accession : NP_309602.1
Strain : Escherichia coli Sakai
Genome accession: NC_002695
Putative virulence/resistance : Virulence
Product : DNA binding protein
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 1596345 - 1596533 bp
Length : 189 bp
Strand : +
Note : similar to DNA binding protein (ORF88) [Bacteriophage P4] gi|140147|sp|P12552|Y9K_BPP4

DNA sequence :
GTGTTAAGCACTGATCGGTTTATACGTGAAAAAGAATGCGAAAAACTAACCGGCCTTAGCCGTACGTGTCGCTACCGCCT
GGAAAAGGCCGGACAATTCCCATCACGTCGTAAACTTGGCGGTCGTTCCGTTGGCTGGTCTTTATCCGAGGTTCTGGCCT
GGAAGGATAGCTGCAAGGCAGTTCATTAA

Protein sequence :
MLSTDRFIREKECEKLTGLSRTCRYRLEKAGQFPSRRKLGGRSVGWSLSEVLAWKDSCKAVH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VPI2_0033 AAX20900.1 transcriptional regulator Not tested VPI-2 Protein 2e-06 44
VC1785 NP_231420.1 transcriptional regulator Not tested VPI-2 Protein 3e-06 44
VC0395_A1382 YP_001217325.1 transcriptional regulator Not tested VPI-2 Protein 3e-06 44
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 0.068 42
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 0.11 42
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 0.11 42
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 0.078 42
VC0497 NP_230151.1 transcriptional regulator Not tested VSP-2 Protein 2e-06 42
ORF SG104 AAN62325.1 phage-related protein Not tested PAGI-3(SG) Protein 4e-05 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECs1575 NP_309602.1 DNA binding protein VFG1118 Protein 9e-07 44
ECs1575 NP_309602.1 DNA binding protein VFG0651 Protein 0.032 42