Gene Information

Name : ECs1404 (ECs1404)
Accession : NP_309431.1
Strain : Escherichia coli Sakai
Genome accession: NC_002695
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1453752 - 1453973 bp
Length : 222 bp
Strand : +
Note : similar to hypothetical protein YeeT [Escherichia coli] gi|3025156|sp|P76363|YEET_ECOLI

DNA sequence :
ATGAGAATCATCACCCGTGGTGAAGCCATGCGTATTCACCAACAGCATCCTGCATCCCGTCTTTTTCCGTTCTGTACCGG
TAAGTATCGCTGGCACGGCAGTGCTGAAGCGTATACTGGTCGTGAAGTGCAGGATATTCCCGGCGTTCTTGCCGTGTTTG
CAGAACGCCGTAAGGACAGTTTTGGCCCGTATGTCCGGCTGATGAGTGTCACCCTGAACTGA

Protein sequence :
MRIITRGEAMRIHQQHPASRLFPFCTGKYRWHGSAEAYTGREVQDIPGVLAVFAERRKDSFGPYVRLMSVTLN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAL08476.1 unknown Not tested SRL Protein 5e-31 100
Z1218 NP_286753.1 hypothetical protein Not tested TAI Protein 8e-31 100
ECO103_3590 YP_003223447.1 hypothetical protein Not tested LEE Protein 2e-30 99
c5151 NP_756999.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-30 98
yeeT CAD33788.1 YeeT protein Not tested PAI I 536 Protein 8e-31 98
yeeT AAZ04459.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 8e-31 98
yeeT CAE85202.1 YeeT protein Not tested PAI V 536 Protein 2e-30 96
unnamed CAD66204.1 hypothetical protein Not tested PAI III 536 Protein 2e-30 96
unnamed CAI43847.1 hypothetical protein Not tested LEE Protein 2e-30 96
unnamed AAL67344.1 intergenic-region protein Not tested PAI II CFT073 Protein 1e-30 96
yeeT ADD91701.1 YeeT Not tested PAI-I AL862 Protein 1e-30 96
yeeT AAK16199.1 YeeT Not tested PAI-I AL862 Protein 1e-30 95
aec74 AAW51757.1 Aec74 Not tested AGI-3 Protein 3e-30 95
unnamed AAK00480.1 unknown Not tested SHI-1 Protein 3e-26 94
unnamed AAL57578.1 unknown Not tested LEE Protein 4e-28 94
unnamed CAI43902.1 hypothetical protein Not tested LEE Protein 4e-28 94
yeeT NP_838485.1 hypothetical protein Not tested SHI-1 Protein 4e-30 94
yeeT CAD42099.1 hypothetical protein Not tested PAI II 536 Protein 3e-30 94
yeeT NP_708771.1 hypothetical protein Not tested SHI-1 Protein 4e-30 94

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECs1404 NP_309431.1 hypothetical protein VFG1067 Protein 2e-31 100
ECs1404 NP_309431.1 hypothetical protein VFG1529 Protein 3e-31 98
ECs1404 NP_309431.1 hypothetical protein VFG1679 Protein 9e-31 96
ECs1404 NP_309431.1 hypothetical protein VFG0661 Protein 1e-30 94
ECs1404 NP_309431.1 hypothetical protein VFG1618 Protein 1e-30 94