Gene Information

Name : ECs1355 (ECs1355)
Accession : NP_309382.1
Strain : Escherichia coli Sakai
Genome accession: NC_002695
Putative virulence/resistance : Resistance
Product : protein TerD
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1415826 - 1416404 bp
Length : 579 bp
Strand : +
Note : tellurium resistance protein; similar to terD proteins e.g. [Serratia marcescens] gi|6094448|sp|Q52357|TERD_SERMA

DNA sequence :
ATGAGTGTTTCTCTTTCCAAAGGCGGGAACGTCTCCCTGAGTAAAGCAGCTCCGTCAATGAAAAATGTCCTGGTGGGCCT
TGGCTGGGATGCGCGTTCAACAGACGGTCAGGACTTTGACCTGGATGCTTCAGCATTCCTGCTGGCCTCAAACGGCAAAG
TGCGCGGCGATTCAGATTTCATCTTCTATAACAACCTGACGTCATCCGACGGTTCCGTAACGCACACCGGCGATAACCGC
ACCGGTGAGGGCGATGGTGATGATGAATCGCTGAAAATTAAACTGGACGCCGTCCCGTCTGAAGTTGACAAGATCATCTT
CGTTGTGACCATCCACGATGCTCAGGCTCGTCGCCAGAGCTTTGGTCAGGTATCCGGTGCGTTTATTCGTCTGGTTAATG
ACGATAACCAGACTGAAGTCGCTCGCTACGATCTGACCGAAGATGCGTCCACTGAGACTGCCATGCTGTTCGGCGAGCTG
TATCGCCACAATGGTGAGTGGAAATTCCGCGCAGTAGGCCAGGGTTATGCTGGTGGTCTGGCATCTGTATGTGCTCAGTA
CGGCATTAACGCGTCCTGA

Protein sequence :
MSVSLSKGGNVSLSKAAPSMKNVLVGLGWDARSTDGQDFDLDASAFLLASNGKVRGDSDFIFYNNLTSSDGSVTHTGDNR
TGEGDGDDESLKIKLDAVPSEVDKIIFVVTIHDAQARRQSFGQVSGAFIRLVNDDNQTEVARYDLTEDASTETAMLFGEL
YRHNGEWKFRAVGQGYAGGLASVCAQYGINAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-83 100
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-83 100
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-83 99
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-66 69
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-59 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-59 63
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-24 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECs1355 NP_309382.1 protein TerD BAC0389 Protein 4e-82 96
ECs1355 NP_309382.1 protein TerD BAC0390 Protein 6e-64 68