Gene Information

Name : fliQ (msr2943)
Accession : NP_104165.1
Strain : Mesorhizobium loti MAFF303099
Genome accession: NC_002678
Putative virulence/resistance : Virulence
Product : flagellar biosynthesis protein FliQ
Function : -
COG functional category : N : Cell motility
COG ID : COG1987
EC number : -
Position : 2367239 - 2367505 bp
Length : 267 bp
Strand : +
Note : FliQ, with proteins FliP and FliR, forms the core of the central channel in the flagella export apparatus; Bradyrhizobium have one thick flagellum and several thin flagella; the protein in this cluster is associated with the thick flagellum

DNA sequence :
ATGAACGAGGCCGACGCTCTCGACATCGTCCAGTACGCGGTGTGGACGGTGCTGACGGCGTCCGCTCCGGTGGTGCTGGT
CGCCATGGCGGTCGGCATCGGCATCGCCCTCATCCAGGCGCTGACGCAGATCCAGGAAATCACCCTGACCTTCGTGCCGA
AGATCGTCGCCATCATGCTGGTGGTGGCGCTCACCGGCCCGTTCATCGGCGGCCAGATATCGGCCTTCACCAACGTCATC
TTCCAGCGCATCCAGAACGGGTTCTGA

Protein sequence :
MNEADALDIVQYAVWTVLTASAPVVLVAMAVGIGIALIQALTQIQEITLTFVPKIVAIMLVVALTGPFIGGQISAFTNVI
FQRIQNGF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
lscS AAO18039.1 LscS Virulence TTSS locus Protein 3e-10 43
ssaS YP_216428.1 secretion system apparatus protein SsaS Virulence SPI-2 Protein 4e-05 42
ssaS NP_460385.1 type III secretion system apparatus protein Virulence SPI-2 Protein 4e-05 42
ssaS CAA68200.1 secretion system apparatus, SsaS Virulence SPI-2 Protein 3e-05 42
escS AFO66341.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 1e-07 42
escS AFO66401.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 1e-07 42
ssaS NP_456108.1 putative type III secretion protein Virulence SPI-2 Protein 4e-05 41
ssaS NP_805091.1 type III secretion protein Virulence SPI-2 Protein 4e-05 41
escS CAC81848.1 EscS protein Virulence LEE II Protein 5e-08 41
escS YP_003223489.1 T3SS structure protein EscS Virulence LEE Protein 7e-08 41
escS YP_003232139.1 T3SS structure protein EscS Virulence LEE Protein 7e-08 41
unnamed AAL06355.1 EscS Virulence LEE Protein 5e-08 41
escS AAK26701.1 EscS Virulence LEE Protein 5e-08 41
escS AAL57528.1 EscS Virulence LEE Protein 5e-08 41
ECs4582 NP_312609.1 EscS Virulence LEE Protein 1e-07 41
escS AAC38370.1 EscS Virulence LEE Protein 8e-08 41
escS AAC31527.1 L0048 Virulence LEE Protein 8e-08 41
escS ACU09472.1 hypothetical protein Not tested LEE Protein 8e-08 41
escS YP_003236102.1 T3SS structure protein EscS Virulence LEE Protein 1e-07 41
escS NP_290282.1 hypothetical protein Virulence LEE Protein 1e-07 41
hrcS AAT96263.1 HrcS Virulence S-PAI Protein 1e-04 41
hrcS AAT96304.1 HrcS Virulence S-PAI Protein 1e-04 41
hrcS AAT96344.1 HrcS Virulence S-PAI Protein 1e-04 41
hrcS ABA47280.1 HrcS Virulence S-PAI Protein 3e-04 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
fliQ NP_104165.1 flagellar biosynthesis protein FliQ VFG0187 Protein 5e-06 42
fliQ NP_104165.1 flagellar biosynthesis protein FliQ VFG0520 Protein 1e-05 42
fliQ NP_104165.1 flagellar biosynthesis protein FliQ VFG2132 Protein 4e-04 42
fliQ NP_104165.1 flagellar biosynthesis protein FliQ VFG0826 Protein 3e-08 41
fliQ NP_104165.1 flagellar biosynthesis protein FliQ VFG0716 Protein 3e-08 41