Name : fliQ (msr2943) Accession : NP_104165.1 Strain : Mesorhizobium loti MAFF303099 Genome accession: NC_002678 Putative virulence/resistance : Virulence Product : flagellar biosynthesis protein FliQ Function : - COG functional category : N : Cell motility COG ID : COG1987 EC number : - Position : 2367239 - 2367505 bp Length : 267 bp Strand : + Note : FliQ, with proteins FliP and FliR, forms the core of the central channel in the flagella export apparatus; Bradyrhizobium have one thick flagellum and several thin flagella; the protein in this cluster is associated with the thick flagellum DNA sequence : ATGAACGAGGCCGACGCTCTCGACATCGTCCAGTACGCGGTGTGGACGGTGCTGACGGCGTCCGCTCCGGTGGTGCTGGT CGCCATGGCGGTCGGCATCGGCATCGCCCTCATCCAGGCGCTGACGCAGATCCAGGAAATCACCCTGACCTTCGTGCCGA AGATCGTCGCCATCATGCTGGTGGTGGCGCTCACCGGCCCGTTCATCGGCGGCCAGATATCGGCCTTCACCAACGTCATC TTCCAGCGCATCCAGAACGGGTTCTGA Protein sequence : MNEADALDIVQYAVWTVLTASAPVVLVAMAVGIGIALIQALTQIQEITLTFVPKIVAIMLVVALTGPFIGGQISAFTNVI FQRIQNGF |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
lscS | AAO18039.1 | LscS | Virulence | TTSS locus | Protein | 3e-10 | 43 |
ssaS | YP_216428.1 | secretion system apparatus protein SsaS | Virulence | SPI-2 | Protein | 4e-05 | 42 |
ssaS | NP_460385.1 | type III secretion system apparatus protein | Virulence | SPI-2 | Protein | 4e-05 | 42 |
ssaS | CAA68200.1 | secretion system apparatus, SsaS | Virulence | SPI-2 | Protein | 3e-05 | 42 |
escS | AFO66341.1 | putative LEE-encoded type III secretion system factor | Virulence | SESS LEE | Protein | 1e-07 | 42 |
escS | AFO66401.1 | putative LEE-encoded type III secretion system factor | Virulence | SESS LEE | Protein | 1e-07 | 42 |
ssaS | NP_456108.1 | putative type III secretion protein | Virulence | SPI-2 | Protein | 4e-05 | 41 |
ssaS | NP_805091.1 | type III secretion protein | Virulence | SPI-2 | Protein | 4e-05 | 41 |
escS | YP_003232139.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 7e-08 | 41 |
unnamed | AAL06355.1 | EscS | Virulence | LEE | Protein | 5e-08 | 41 |
escS | AAK26701.1 | EscS | Virulence | LEE | Protein | 5e-08 | 41 |
escS | AAL57528.1 | EscS | Virulence | LEE | Protein | 5e-08 | 41 |
escS | CAC81848.1 | EscS protein | Virulence | LEE II | Protein | 5e-08 | 41 |
escS | YP_003223489.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 7e-08 | 41 |
escS | AAC38370.1 | EscS | Virulence | LEE | Protein | 8e-08 | 41 |
escS | AAC31527.1 | L0048 | Virulence | LEE | Protein | 8e-08 | 41 |
escS | ACU09472.1 | hypothetical protein | Not tested | LEE | Protein | 8e-08 | 41 |
escS | YP_003236102.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 1e-07 | 41 |
escS | NP_290282.1 | hypothetical protein | Virulence | LEE | Protein | 1e-07 | 41 |
ECs4582 | NP_312609.1 | EscS | Virulence | LEE | Protein | 1e-07 | 41 |
hrcS | AAT96263.1 | HrcS | Virulence | S-PAI | Protein | 1e-04 | 41 |
hrcS | AAT96304.1 | HrcS | Virulence | S-PAI | Protein | 1e-04 | 41 |
hrcS | AAT96344.1 | HrcS | Virulence | S-PAI | Protein | 1e-04 | 41 |
hrcS | ABA47280.1 | HrcS | Virulence | S-PAI | Protein | 3e-04 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
fliQ | NP_104165.1 | flagellar biosynthesis protein FliQ | VFG0187 | Protein | 5e-06 | 42 |
fliQ | NP_104165.1 | flagellar biosynthesis protein FliQ | VFG0520 | Protein | 1e-05 | 42 |
fliQ | NP_104165.1 | flagellar biosynthesis protein FliQ | VFG2132 | Protein | 4e-04 | 42 |
fliQ | NP_104165.1 | flagellar biosynthesis protein FliQ | VFG0716 | Protein | 3e-08 | 41 |
fliQ | NP_104165.1 | flagellar biosynthesis protein FliQ | VFG0826 | Protein | 3e-08 | 41 |