Gene Information

Name : yhjE (L195720)
Accession : NP_266943.1
Strain : Lactococcus lactis IL1403
Genome accession: NC_002662
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : S : Function unknown
COG ID : COG1937
EC number : -
Position : 795702 - 795956 bp
Length : 255 bp
Strand : +
Note : similar to YrkD of Bacillus subtilis

DNA sequence :
ATGAAAAAATATGACAAAAAAATGAAAAATCGCTTGAAACGAGCGACGGGACAACTCACAGGAATACTTAAGATGATGGA
ATCTGGAGAGGAATGTATTGATGTTGTGACTCAATTAACCGCTGTTCGCTCTAGCTTAGATAGCCTGATTGGTCTAATCG
TAGCTGAGAATCTCAAAGAACTTTTACTGGATAAAGAAGTGACTGACAAGGAAGAAAAACTCGAACAAGCTATAAAATTA
ATCATTAAAAAATAG

Protein sequence :
MKKYDKKMKNRLKRATGQLTGILKMMESGEECIDVVTQLTAVRSSLDSLIGLIVAENLKELLLDKEVTDKEEKLEQAIKL
IIKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed BAA86632.1 hypothetical protein Not tested Type-I SCCmec Protein 2e-13 49
unnamed BAA82170.2 - Not tested Type-II SCCmec Protein 3e-13 46
SACOL0048 YP_184958.1 hypothetical protein Not tested Type-I SCCmec Protein 4e-12 44
unnamed BAA94324.1 hypothetical protein Not tested Type-I SCCmec Protein 7e-10 43
SAPIG0063 YP_005732873.1 conserved protein YrkD Not tested Type-V SCCmec Protein 6e-12 43
SERP2514 YP_190056.1 hypothetical protein Not tested Type-II SCCmec Protein 4e-12 42
unnamed BAC57484.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 3e-12 42
unnamed BAA82210.2 - Not tested Type-II SCCmec Protein 3e-12 42
SAV0048 NP_370572.1 hypothetical protein Not tested Type-II SCCmec Protein 4e-12 42
SA0045 NP_373285.1 hypothetical protein Not tested Type-II SCCmec Protein 4e-12 42
SAR0047 YP_039520.1 hypothetical protein Not tested Type-II SCCmec Protein 4e-12 42
unnamed BAB47614.1 hypothetical protein Not tested Type-III SCCmec Protein 3e-12 42