Gene Information

Name : Z5140 (Z5140)
Accession : NP_290288.1
Strain : Escherichia coli EDL933
Genome accession: NC_002655
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : R : General function prediction only
COG ID : COG2916
EC number : -
Position : 4688769 - 4689158 bp
Length : 390 bp
Strand : -
Note : -

DNA sequence :
ATGCGGAGATTATTTATTATGAATATGGAAAATAATTCACATACAACAAGTCCATACATTCAGCTTATAGAGCAAATTGC
AGTTCTACAGCAGGAAGCAAAGCGACTGCGAGAGCAGGAAGTTCAAAGTGTAATTGAGTCGATTCAGAAGCAGATTACTT
ATTACAATATAACCTTACAAGAGCTGGGATATACTAATGTGCCTGATGATGGACTCGCTCGCCGGAACTCATCGAAAGGT
GTTTACTACCGCAATGAAGAAGGGCAGACCTGGTCGGGCGTAGGCCGACAGCCACGCTGGCTTAAAGAAGCACTGTTGAA
TGGAATGAAGAAAGAAGATTTTCTTGTGAAGGACACTGAAGAAGAAATAATACCGCTGAAAAATATTTAA

Protein sequence :
MRRLFIMNMENNSHTTSPYIQLIEQIAVLQQEAKRLREQEVQSVIESIQKQITYYNITLQELGYTNVPDDGLARRNSSKG
VYYRNEEGQTWSGVGRQPRWLKEALLNGMKKEDFLVKDTEEEIIPLKNI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ler ACU09478.1 transcription regulator Ler Not tested LEE Protein 4e-56 100
Z5140 NP_290288.1 hypothetical protein Not tested LEE Protein 6e-56 100
ECs4588 NP_312615.1 hypothetical protein Virulence LEE Protein 6e-56 100
unnamed AAC31533.1 L0054 Not tested LEE Protein 4e-56 100
ler YP_003236108.1 transcriptional regulator Ler Not tested LEE Protein 8e-56 99
unnamed AAC38364.1 Orf1 Virulence LEE Protein 5e-56 99
ler YP_003223495.1 transcription regulator Ler Not tested LEE Protein 2e-55 97
ler AAK26696.1 Ler Virulence LEE Protein 2e-55 97
ler YP_003232133.1 transcriptional regulator Ler Not tested LEE Protein 2e-55 97
ler AAL57523.1 Ler Virulence LEE Protein 2e-55 97
ler AAL57584.1 Ler Virulence LEE Protein 2e-55 97
ler CAC81843.1 Ler protein Not tested LEE II Protein 2e-55 97
unnamed AAL06349.1 LEE-encoded regulator Virulence LEE Protein 4e-52 90
ler CAI43893.1 LEE encoded regulator Virulence LEE Protein 7e-41 86
ler AFO66332.1 locus of enterocyte effacement-encoded regulator Virulence SESS LEE Protein 3e-36 65
ler AFO66395.1 locus of enterocyte effacement (LEE)-encoded regulator Virulence SESS LEE Protein 3e-36 65

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Z5140 NP_290288.1 hypothetical protein VFG0832 Protein 2e-56 100
Z5140 NP_290288.1 hypothetical protein VFG0710 Protein 2e-56 99