Gene Information

Name : Z5129 (Z5129)
Accession : NP_290278.1
Strain : Escherichia coli EDL933
Genome accession: NC_002655
Putative virulence/resistance : Virulence
Product : negative regulator GrlR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4683218 - 4683589 bp
Length : 372 bp
Strand : -
Note : -

DNA sequence :
ATGATTATGAAGGATGGCATCTATAGCATTATATTTATTAGCAATGAAGACTCCTGTGGGGAAGGTATACTGATTAAAAA
TGGAAATATGATCACTGGCGGCGATATTGCTTCTGTGTATCAGGGGGTCCTCTCTGAAGATGAGGACATCATACTTCATG
TCCATCGATATAATTACGAAATTCCCTCGGTGCTAAACATTGAACAAGATTATCAATTAGTTATCCCTAAAAAAGTACTG
AGTAATGATAATAATCTCACATTACATTGCCATGTAAGAGGAAATGAAAAATTGTTTGTTGATGTTTATGCCAAATTTAT
AGAACCATTAGTTATTAAAAACACAGGAATGCCACAAGTTTATTTAAAATAA

Protein sequence :
MIMKDGIYSIIFISNEDSCGEGILIKNGNMITGGDIASVYQGVLSEDEDIILHVHRYNYEIPSVLNIEQDYQLVIPKKVL
SNDNNLTLHCHVRGNEKLFVDVYAKFIEPLVIKNTGMPQVYLK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z5129 NP_290278.1 negative regulator GrlR Not tested LEE Protein 3e-53 100
ECs4578 NP_312605.1 negative regulator GrlR Not tested LEE Protein 3e-53 100
unnamed AAC31523.1 L0044 Not tested LEE Protein 2e-53 100
unnamed ACU09468.1 type three secretion system protein GrlR Virulence LEE Protein 2e-53 100
grlR YP_003236098.1 negative regulator GrlR Not tested LEE Protein 3e-53 99
unnamed AAC38374.1 Orf10 Not tested LEE Protein 7e-53 99
unnamed AAK26705.1 unknown Not tested LEE Protein 1e-47 92
grlR YP_003232143.1 negative regulator GrlR Not tested LEE Protein 2e-47 92
unnamed AAL57532.1 unknown Not tested LEE Protein 1e-47 92
st14 CAC81852.1 ST14 protein Not tested LEE II Protein 1e-47 92
unnamed CAI43884.1 hypothetical protein Not tested LEE Protein 2e-47 92
grlR YP_003223485.1 negative regulator GrlR Not tested LEE Protein 3e-47 92
unnamed AAL06359.1 unknown Not tested LEE Protein 1e-43 88
grlR AFO66337.1 putative LEE-encoded negative regulator of transcription Not tested SESS LEE Protein 5e-22 53
grlR AFO66405.1 putative LEE-encoded negative regulator of transcription Virulence SESS LEE Protein 5e-22 53

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Z5129 NP_290278.1 negative regulator GrlR VFG0822 Protein 8e-54 100
Z5129 NP_290278.1 negative regulator GrlR VFG0720 Protein 3e-53 99