Name : rpmE2 (Z1591) Accession : NP_287095.1 Strain : Escherichia coli EDL933 Genome accession: NC_002655 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L31 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0254 EC number : - Position : 1480366 - 1480629 bp Length : 264 bp Strand : + Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g DNA sequence : GTGAAACCGAATATCCATCCGGAATACCGTACAGTAGTATTTCACGATACCAGTATTGATGAGTACTTCAGGATCGGTTC GACGATCAAAACTGACCGGGTAATTGAACTGGATGGTGTAACTTACCCATATGTTACAATTGACGTTTCTTCTAAGTCGC ATCCGTTTTATACAGGTAAACTGAGAACTGTCGCTTCAGAAGGTAATGTTGCACGCTTTACCCAGCGTTTTGGGCGTTTT GTTGATGCGAAAAAAGGTGGCTGA Protein sequence : MKPNIHPEYRTVVFHDTSIDEYFRIGSTIKTDRVIELDGVTYPYVTIDVSSKSHPFYTGKLRTVASEGNVARFTQRFGRF VDAKKGG |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
rpmE2 | NP_286687.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 4e-36 | 100 |
rpmE2 | NP_287095.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 4e-36 | 100 |