Gene Information

Name : Z1220 (Z1220)
Accession : NP_286755.1
Strain : Escherichia coli EDL933
Genome accession: NC_002655
Putative virulence/resistance : Virulence
Product : structural protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1142302 - 1142676 bp
Length : 375 bp
Strand : +
Note : -

DNA sequence :
GTGTCAGACAAACTCTCCGGGATAACTCATCCCGATGACAATCACGACCGCCCCTGGTGGGGGCTTCCCTGCACAGTGAG
GCCCTGTTTTGGCGCTCGTCTGGTGCAAGAGGGTAACCGCCTGCATTACCTTGCCGACCGCGCCGGTATCAGAGGCCGCT
TCAGCGACGCAGATGCATACCATCTGGACCAGGCCTTTCCGCTGCTGATGAAACAACTGGAACTCATGCTCACCAGCGGT
GAACTGAATCCCCGATATCAGCATACCGTCACGCTGAATGCAAAAGGGCTGACCTGCGAAGCCGACACCCTCGGCTCCTG
TGGTTACGTTTATCTGGCTGTTTATCCGACACCAGCACCCGCAACCACCTCATAA

Protein sequence :
MSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLNAKGLTCEADTLGSCGYVYLAVYPTPAPATTS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1220 NP_286755.1 structural protein Not tested TAI Protein 8e-55 100
Z1658 NP_287161.1 structural protein Not tested TAI Protein 8e-55 100
aec75 AAW51758.1 Aec75 Not tested AGI-3 Protein 1e-51 97
unnamed AAL08477.1 unknown Not tested SRL Protein 6e-53 96
yeeU CAD42100.1 hypothetical protein Not tested PAI II 536 Protein 1e-48 91
yeeU YP_853121.1 antitoxin of the YeeV-YeeU toxin-antitoxin system Virulence PAI IV APEC-O1 Protein 3e-47 91
yeeU CAE85203.1 YeeU protein Not tested PAI V 536 Protein 1e-48 91
c5150 NP_756998.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-48 91
unnamed CAI43903.1 hypothetical protein Not tested LEE Protein 3e-48 91
yeeU NP_838486.1 structural protein Not tested SHI-1 Protein 6e-50 90
yeeU NP_708772.1 structural protein Not tested SHI-1 Protein 6e-50 90
yeeU ADD91700.1 YeeU Not tested PAI-I AL862 Protein 9e-48 90
unnamed CAD66206.1 hypothetical protein Not tested PAI III 536 Protein 3e-46 90
yeeU YP_854324.1 hypothetical protein Not tested PAI I APEC-O1 Protein 3e-50 90
yeeU AAZ04460.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 2e-50 90
unnamed AAL57576.1 unknown Not tested LEE Protein 5e-48 90
unnamed AAK00481.1 unknown Not tested SHI-1 Protein 1e-49 89
ECO103_3591 YP_003223448.1 hypothetical protein Not tested LEE Protein 5e-47 87
unnamed AAL67343.1 intergenic-region protein Not tested PAI II CFT073 Protein 3e-47 87

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Z1220 NP_286755.1 structural protein VFG1068 Protein 2e-53 96
Z1220 NP_286755.1 structural protein VFG1619 Protein 5e-49 91
Z1220 NP_286755.1 structural protein VFG0662 Protein 2e-50 90
Z1220 NP_286755.1 structural protein VFG1681 Protein 1e-46 90