Name : Z1188 (Z1188) Accession : NP_286723.1 Strain : Escherichia coli EDL933 Genome accession: NC_002655 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 1113397 - 1113594 bp Length : 198 bp Strand : + Note : No significant matches DNA sequence : ATGTTGACTACAACAAGCCACGACAGCGTATTTCTGCGTGCCGATAATTCCCTGATCGACATGAACTATATCACCAGTTT CACCGGTATGACCGACAAATGGTTTTACAAGTTGATCAGTGAAGGCCATTTCCCTAAACCCATCAAACTGGGGCGCAGCA GCCGCTGGTACAAAAGTGAAGTGGAGCAGTGGAAGTGA Protein sequence : MLTTTSHDSVFLRADNSLIDMNYITSFTGMTDKWFYKLISEGHFPKPIKLGRSSRWYKSEVEQWK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 1e-25 | 100 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 1e-25 | 100 |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 4e-25 | 96 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 6e-25 | 96 |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 8e-15 | 70 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 2e-14 | 70 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 2e-14 | 70 |
ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 1e-14 | 70 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 1e-14 | 70 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
Z1188 | NP_286723.1 | hypothetical protein | VFG1480 | Protein | 2e-25 | 96 |
Z1188 | NP_286723.1 | hypothetical protein | VFG0651 | Protein | 6e-15 | 70 |