Gene Information

Name : Z1188 (Z1188)
Accession : NP_286723.1
Strain : Escherichia coli EDL933
Genome accession: NC_002655
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 1113397 - 1113594 bp
Length : 198 bp
Strand : +
Note : No significant matches

DNA sequence :
ATGTTGACTACAACAAGCCACGACAGCGTATTTCTGCGTGCCGATAATTCCCTGATCGACATGAACTATATCACCAGTTT
CACCGGTATGACCGACAAATGGTTTTACAAGTTGATCAGTGAAGGCCATTTCCCTAAACCCATCAAACTGGGGCGCAGCA
GCCGCTGGTACAAAAGTGAAGTGGAGCAGTGGAAGTGA

Protein sequence :
MLTTTSHDSVFLRADNSLIDMNYITSFTGMTDKWFYKLISEGHFPKPIKLGRSSRWYKSEVEQWK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 1e-25 100
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 1e-25 100
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 4e-25 96
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 6e-25 96
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 8e-15 70
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 2e-14 70
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 2e-14 70
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 1e-14 70
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 1e-14 70

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Z1188 NP_286723.1 hypothetical protein VFG1480 Protein 2e-25 96
Z1188 NP_286723.1 hypothetical protein VFG0651 Protein 6e-15 70