Gene Information

Name : BH4027 (BH4027)
Accession : NP_244895.1
Strain : Bacillus halodurans C-125
Genome accession: NC_002570
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4162111 - 4162821 bp
Length : 711 bp
Strand : -
Note : -

DNA sequence :
ATGGAAAATAAAAAAATTCTAGTTGTTGACGACGAAAAGCCAATTGCAGATATACTGAAATTCAATTTAGAAAAAGAAGG
GTTTACCGTCATATGTGCCTATGATGGAGCTGAAGCTGTGGAACAGGTGAATCAGGAAAAGCCGGATTTAATTTTGCTAG
ATATCATGCTACCGAATAAAGACGGTATGGAAGTGTGCCGAGAGGTTCGTAAGCAATTTGAGATGCCGATCATCATGCTG
ACCGCAAAAGACTCGGAAATCGATAAAGTGTTAGGCCTTGAATTAGGGGCCGATGACTACGTGACAAAGCCATTTAGTAC
CCGAGAGCTATTAGCGAGAGTGAAGGCGAATTTGCGTCGTCACCAAACATCTGGCGACGATCAACTCTCGTATAAGGAAA
TCTCAGTCGGAGATTTATCGATCCACCCAGAGGCCTATCTCGTGAAAAAACGCGGAGAATCCATCGAACTCACTCATCGA
GAATTTGAGCTTATACATTACTTAGCCAAGCATCTAGGCCAAGTGATGACCCGTGAGCACCTGCTGCAGGCTGTATGGGG
CTATGATTACTTCGGAGATGTCCGCACAGTCGATGTCACCGTTCGTCGCCTCAGAGAGAAAGTAGAGGACAATCCTAGCT
ATCCAACGTGGATTATTACACGCCGTGGAGTCGGGTACTATTTGCGTCACCCTGAGCAGGAGAATGCTTAA

Protein sequence :
MENKKILVVDDEKPIADILKFNLEKEGFTVICAYDGAEAVEQVNQEKPDLILLDIMLPNKDGMEVCREVRKQFEMPIIML
TAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLRRHQTSGDDQLSYKEISVGDLSIHPEAYLVKKRGESIELTHR
EFELIHYLAKHLGQVMTREHLLQAVWGYDYFGDVRTVDVTVRRLREKVEDNPSYPTWIITRRGVGYYLRHPEQENA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-34 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BH4027 NP_244895.1 two-component response regulator NC_012469.1.7685629. Protein 8e-64 65
BH4027 NP_244895.1 two-component response regulator NC_002952.2859905.p0 Protein 3e-53 54
BH4027 NP_244895.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-53 53
BH4027 NP_244895.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-53 53
BH4027 NP_244895.1 two-component response regulator NC_007622.3794472.p0 Protein 2e-53 53
BH4027 NP_244895.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-53 53
BH4027 NP_244895.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-53 53
BH4027 NP_244895.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-53 53
BH4027 NP_244895.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-53 53
BH4027 NP_244895.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-53 53
BH4027 NP_244895.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-53 53
BH4027 NP_244895.1 two-component response regulator HE999704.1.gene2815. Protein 8e-46 51
BH4027 NP_244895.1 two-component response regulator NC_012469.1.7686381. Protein 8e-40 50
BH4027 NP_244895.1 two-component response regulator AE000516.2.gene3505. Protein 9e-37 48
BH4027 NP_244895.1 two-component response regulator FJ349556.1.orf0.gene Protein 5e-36 45
BH4027 NP_244895.1 two-component response regulator CP004022.1.gene3215. Protein 3e-35 45
BH4027 NP_244895.1 two-component response regulator HE999704.1.gene1528. Protein 1e-28 44
BH4027 NP_244895.1 two-component response regulator AF155139.2.orf0.gene Protein 3e-34 44
BH4027 NP_244895.1 two-component response regulator AE016830.1.gene1681. Protein 1e-42 44
BH4027 NP_244895.1 two-component response regulator CP001918.1.gene5135. Protein 5e-27 44
BH4027 NP_244895.1 two-component response regulator AF162694.1.orf4.gene Protein 9e-32 43
BH4027 NP_244895.1 two-component response regulator BAC0533 Protein 6e-32 43
BH4027 NP_244895.1 two-component response regulator CP001138.1.gene4273. Protein 2e-31 43
BH4027 NP_244895.1 two-component response regulator CP000647.1.gene4257. Protein 6e-32 43
BH4027 NP_244895.1 two-component response regulator AM180355.1.gene1830. Protein 3e-36 43
BH4027 NP_244895.1 two-component response regulator NC_014475.1.orf0.gen Protein 1e-33 42
BH4027 NP_244895.1 two-component response regulator NC_005054.2598277.p0 Protein 1e-33 42
BH4027 NP_244895.1 two-component response regulator NC_002695.1.915041.p Protein 2e-31 42
BH4027 NP_244895.1 two-component response regulator CP000034.1.gene3834. Protein 2e-31 42
BH4027 NP_244895.1 two-component response regulator AF130997.1.orf0.gene Protein 1e-32 42
BH4027 NP_244895.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-34 42
BH4027 NP_244895.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-34 42
BH4027 NP_244895.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-34 42
BH4027 NP_244895.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-34 42
BH4027 NP_244895.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-34 42
BH4027 NP_244895.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-34 42
BH4027 NP_244895.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-34 42
BH4027 NP_244895.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-34 42
BH4027 NP_244895.1 two-component response regulator NC_010410.6002989.p0 Protein 3e-28 42
BH4027 NP_244895.1 two-component response regulator NC_011595.7057856.p0 Protein 3e-28 42
BH4027 NP_244895.1 two-component response regulator CP001485.1.gene721.p Protein 9e-27 41
BH4027 NP_244895.1 two-component response regulator DQ212986.1.gene4.p01 Protein 4e-34 41
BH4027 NP_244895.1 two-component response regulator CP004022.1.gene1676. Protein 7e-28 41
BH4027 NP_244895.1 two-component response regulator NC_002695.1.916589.p Protein 6e-29 41
BH4027 NP_244895.1 two-component response regulator BAC0039 Protein 7e-29 41
BH4027 NP_244895.1 two-component response regulator CP000034.1.gene2186. Protein 7e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BH4027 NP_244895.1 two-component response regulator VFG1389 Protein 7e-29 43
BH4027 NP_244895.1 two-component response regulator VFG1563 Protein 4e-34 42
BH4027 NP_244895.1 two-component response regulator VFG1702 Protein 5e-34 42
BH4027 NP_244895.1 two-component response regulator VFG1390 Protein 3e-34 41