Gene Information

Name : BH0372 (BH0372)
Accession : NP_241238.1
Strain : Bacillus halodurans C-125
Genome accession: NC_002570
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 401097 - 401765 bp
Length : 669 bp
Strand : +
Note : -

DNA sequence :
GTGGCTCGTATATTAATCATTGAGGATGAAAAGAAAATTGCCCGTGTCCTTCAGCTTGAATTGGAGCATGAAGGGTACGA
GACGGACGCTGCTTTTTCAGGCAGTGATGGACTCGAAACGTTTCAAGCACACGCGTGGGATTTAGTGTTGCTTGACGTGA
TGCTGCCAGAGCTTAGTGGGCTTGAAGTCCTTAGGCGGATTCGGATGACAGATCCGGTCACCCCGATTATTTTGTTAACC
GCACGAAATTCGATCCCTGACAAAGTAAGCGGCCTCGATTTAGGGGCAAATGATTATATTACGAAGCCCTTTGAGATTGA
AGAGCTATTAGCGAGAGTTCGAGCGTGCCTTCGTACAGTGCAAACGAGGGAGCGAGTAGAAGACACGCTGATGTTTCAAG
AGTTAACGATCAATGAAAAAACGAGGGATGTGCAGCGCGGGAATGAAACCATTGAGCTTACTCCAAAAGAGTTTGAACTT
CTCGTATTTTTTATTAAAAATAAAGGGCAAGTGCTGAGCCGGGAGCAAATTTTAACCAACGTCTGGGGCTTTGACTATTA
TGGCGACACGAATGTAATCGATGTCTACGTTCGGTATTTGCGGAAAAAGCTGTCCTTAACGGAGGCGCTCCAAACCGTCC
GCGGGGTCGGCTACCGGCTAAAGGAGTAA

Protein sequence :
MARILIIEDEKKIARVLQLELEHEGYETDAAFSGSDGLETFQAHAWDLVLLDVMLPELSGLEVLRRIRMTDPVTPIILLT
ARNSIPDKVSGLDLGANDYITKPFEIEELLARVRACLRTVQTRERVEDTLMFQELTINEKTRDVQRGNETIELTPKEFEL
LVFFIKNKGQVLSREQILTNVWGFDYYGDTNVIDVYVRYLRKKLSLTEALQTVRGVGYRLKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-33 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BH0372 NP_241238.1 two-component response regulator HE999704.1.gene1528. Protein 1e-46 51
BH0372 NP_241238.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-47 49
BH0372 NP_241238.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-47 49
BH0372 NP_241238.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-47 49
BH0372 NP_241238.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-47 49
BH0372 NP_241238.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-47 49
BH0372 NP_241238.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-47 49
BH0372 NP_241238.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-47 49
BH0372 NP_241238.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-47 49
BH0372 NP_241238.1 two-component response regulator AE015929.1.gene1106. Protein 2e-39 46
BH0372 NP_241238.1 two-component response regulator NC_012469.1.7685629. Protein 6e-41 43
BH0372 NP_241238.1 two-component response regulator BAC0347 Protein 2e-34 43
BH0372 NP_241238.1 two-component response regulator BAC0308 Protein 7e-37 43
BH0372 NP_241238.1 two-component response regulator BAC0125 Protein 3e-39 43
BH0372 NP_241238.1 two-component response regulator BAC0111 Protein 7e-37 42
BH0372 NP_241238.1 two-component response regulator AF155139.2.orf0.gene Protein 1e-34 42
BH0372 NP_241238.1 two-component response regulator BAC0083 Protein 5e-39 42
BH0372 NP_241238.1 two-component response regulator NC_003923.1003749.p0 Protein 4e-41 42
BH0372 NP_241238.1 two-component response regulator HE999704.1.gene1202. Protein 4e-35 41
BH0372 NP_241238.1 two-component response regulator FJ349556.1.orf0.gene Protein 5e-32 41
BH0372 NP_241238.1 two-component response regulator NC_002952.2859905.p0 Protein 8e-41 41
BH0372 NP_241238.1 two-component response regulator BAC0197 Protein 8e-37 41
BH0372 NP_241238.1 two-component response regulator NC_013450.8614421.p0 Protein 6e-41 41
BH0372 NP_241238.1 two-component response regulator NC_007793.3914279.p0 Protein 6e-41 41
BH0372 NP_241238.1 two-component response regulator NC_002745.1124361.p0 Protein 6e-41 41
BH0372 NP_241238.1 two-component response regulator NC_009782.5559369.p0 Protein 6e-41 41
BH0372 NP_241238.1 two-component response regulator NC_002951.3237708.p0 Protein 6e-41 41
BH0372 NP_241238.1 two-component response regulator NC_007622.3794472.p0 Protein 7e-41 41
BH0372 NP_241238.1 two-component response regulator NC_002758.1121668.p0 Protein 6e-41 41
BH0372 NP_241238.1 two-component response regulator NC_009641.5332272.p0 Protein 6e-41 41
BH0372 NP_241238.1 two-component response regulator BAC0638 Protein 2e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BH0372 NP_241238.1 two-component response regulator VFG1390 Protein 1e-43 44
BH0372 NP_241238.1 two-component response regulator VFG0596 Protein 3e-33 42
BH0372 NP_241238.1 two-component response regulator VFG1386 Protein 5e-45 42