Gene Information

Name : pmrA (PA4776)
Accession : NP_253464.1
Strain : Pseudomonas aeruginosa PAO1
Genome accession: NC_002516
Putative virulence/resistance : Virulence
Product : PmrA: two-component regulator system response regulator PmrA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5364071 - 5364736 bp
Length : 666 bp
Strand : +
Note : Product name confidence: class 1 (Function experimentally demonstrated in P. aeruginosa)

DNA sequence :
ATGAGAATACTGCTGGCCGAGGACGACCTGCTGCTCGGCGACGGCATCCGCGCCGGGCTGCGCCTGGAAGGCGATACCGT
GGAATGGGTGACCGACGGCGTGGCCGCGGAGAACGCGCTGGTCACCGACGAGTTCGACCTGCTGGTGCTCGACATCGGAC
TGCCGCGCCGCAGCGGCCTGGACATCCTGCGCAACCTGCGTCACCAGGGCCTGCTCACCCCGGTGCTGCTGCTCACCGCG
CGGGACAAGGTGGCCGACCGGGTCGCCGGGCTCGACAGCGGTGCCGACGACTACCTGACCAAGCCCTTCGATCTCGACGA
ACTGCAGGCACGGGTGCGCGCCCTGACCCGCCGCACCACCGGTCGCGCCCTGCCGCAACTGGTGCACGGCGAGCTGCGCC
TGGACCCGGCGACCCACCAGGTGACCCTGTCCGGGCAGGCGGTGGAACTGGCGCCGCGCGAATACGCACTGCTGCGCCTG
CTGCTGGAGAACAGCGGCAAGGTGCTCTCGCGCAACCAACTGGAGCAGAGCCTCTACGGCTGGAGCGGCGACGTCGAGAG
CAACGCCATCGAAGTCCACGTCCACCACCTGCGGCGCAAGCTCGGCAACCAGTTGATCCGCACCGTCCGCGGCATCGGCT
ACGGCATCGACCAGCCGGCGCCCTGA

Protein sequence :
MRILLAEDDLLLGDGIRAGLRLEGDTVEWVTDGVAAENALVTDEFDLLVLDIGLPRRSGLDILRNLRHQGLLTPVLLLTA
RDKVADRVAGLDSGADDYLTKPFDLDELQARVRALTRRTTGRALPQLVHGELRLDPATHQVTLSGQAVELAPREYALLRL
LLENSGKVLSRNQLEQSLYGWSGDVESNAIEVHVHHLRRKLGNQLIRTVRGIGYGIDQPAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 8e-30 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pmrA NP_253464.1 PmrA: two-component regulator system response regulator PmrA BAC0487 Protein 9e-32 46
pmrA NP_253464.1 PmrA: two-component regulator system response regulator PmrA NC_002516.2.879194.p Protein 3e-21 42
pmrA NP_253464.1 PmrA: two-component regulator system response regulator PmrA NC_003923.1003417.p0 Protein 2e-24 42
pmrA NP_253464.1 PmrA: two-component regulator system response regulator PmrA NC_013450.8614146.p0 Protein 2e-24 42
pmrA NP_253464.1 PmrA: two-component regulator system response regulator PmrA NC_002951.3238224.p0 Protein 2e-24 42
pmrA NP_253464.1 PmrA: two-component regulator system response regulator PmrA NC_007793.3914065.p0 Protein 2e-24 42
pmrA NP_253464.1 PmrA: two-component regulator system response regulator PmrA NC_002758.1121390.p0 Protein 2e-24 42
pmrA NP_253464.1 PmrA: two-component regulator system response regulator PmrA NC_010079.5776364.p0 Protein 2e-24 42
pmrA NP_253464.1 PmrA: two-component regulator system response regulator PmrA NC_002952.2859858.p0 Protein 2e-24 42
pmrA NP_253464.1 PmrA: two-component regulator system response regulator PmrA NC_007622.3794948.p0 Protein 2e-24 42
pmrA NP_253464.1 PmrA: two-component regulator system response regulator PmrA BAC0308 Protein 1e-23 41
pmrA NP_253464.1 PmrA: two-component regulator system response regulator PmrA CP000647.1.gene4257. Protein 4e-19 41
pmrA NP_253464.1 PmrA: two-component regulator system response regulator PmrA BAC0533 Protein 4e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pmrA NP_253464.1 PmrA: two-component regulator system response regulator PmrA VFG0473 Protein 2e-34 46
pmrA NP_253464.1 PmrA: two-component regulator system response regulator PmrA VFG1390 Protein 2e-29 43