Gene Information

Name : copR (PA2809)
Accession : NP_251499.1
Strain : Pseudomonas aeruginosa PAO1
Genome accession: NC_002516
Putative virulence/resistance : Virulence
Product : two-component response regulator, CopR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3162705 - 3163385 bp
Length : 681 bp
Strand : +
Note : class 1: Function experimentally demonstrated in P. aeruginosa

DNA sequence :
ATGAAACTGCTGATCGTCGAAGACGAACCGCGCATCGGCCAGTACCTGCGCCAGGGGCTCGCCGAGGCAGGCTTCGCCGT
CGACCTGAGCGACGATGGCAACGAGGGCGAGCAACTGGCCCTGGGCGGCGACTACGACCTGCTGATCCTCGACGTCATGC
TGCCCGGCCGTGACGGCTGGCAGATCCTGCGCAGCGTGCGCGACGCCGGGATGACCGTACCGGTGCTGTTCCTGACCGCC
CGCGATGCCGTAGAGGACCGCGTGCGCGGCCTCGAACAAGGCGCCGACGATTACCTGGTGAAGCCGTTCGCCTTCGTCGA
ACTGCTCGCCCGGGTGCGCACCCTGCTGCGCCGGGGCAGCCAGCAGTTGCAGGAGACCACCCTGCAACTGGCCGACCTCG
AACTCGATTTGCTGCGCCGCCGGGTGCAACGCCAGGGCAAGCGGATCGACCTCACCGCCAAGGAGTTCGCCCTGCTCGAA
CTGCTGCTGCGGCGCAGCGGCGAGGTGCTGCCCAAGTCGCTGATCGCCTCGCAGGTCTGGGACATGAACTTCGACAGCGA
TACCAACGTCATCGAGGTGGCCATCCGCCGCCTGCGCGCCAAGGTCGACGACGACTACCCGCAGCGCCTGATCCATACCG
TGCGCGGCATGGGCTACGTTCTCGAAGAGCGCGACGAATGA

Protein sequence :
MKLLIVEDEPRIGQYLRQGLAEAGFAVDLSDDGNEGEQLALGGDYDLLILDVMLPGRDGWQILRSVRDAGMTVPVLFLTA
RDAVEDRVRGLEQGADDYLVKPFAFVELLARVRTLLRRGSQQLQETTLQLADLELDLLRRRVQRQGKRIDLTAKEFALLE
LLLRRSGEVLPKSLIASQVWDMNFDSDTNVIEVAIRRLRAKVDDDYPQRLIHTVRGMGYVLEERDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-52 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-51 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR NP_251499.1 two-component response regulator, CopR BAC0638 Protein 5e-61 73
copR NP_251499.1 two-component response regulator, CopR BAC0083 Protein 8e-67 72
copR NP_251499.1 two-component response regulator, CopR BAC0111 Protein 5e-64 64
copR NP_251499.1 two-component response regulator, CopR BAC0308 Protein 1e-60 62
copR NP_251499.1 two-component response regulator, CopR BAC0197 Protein 3e-58 60
copR NP_251499.1 two-component response regulator, CopR BAC0347 Protein 3e-56 59
copR NP_251499.1 two-component response regulator, CopR BAC0125 Protein 4e-58 59
copR NP_251499.1 two-component response regulator, CopR BAC0487 Protein 2e-26 42
copR NP_251499.1 two-component response regulator, CopR NC_002516.2.879194.p Protein 9e-25 42
copR NP_251499.1 two-component response regulator, CopR HE999704.1.gene1528. Protein 3e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR NP_251499.1 two-component response regulator, CopR VFG0596 Protein 1e-52 57
copR NP_251499.1 two-component response regulator, CopR VFG1390 Protein 1e-36 46
copR NP_251499.1 two-component response regulator, CopR VFG1389 Protein 2e-28 43
copR NP_251499.1 two-component response regulator, CopR VFG0473 Protein 1e-27 41