
|
Name : PA1937 (PA1937) Accession : NP_250627.1 Strain : Pseudomonas aeruginosa PAO1 Genome accession: NC_002516 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : L : Replication, recombination and repair COG ID : COG2963 EC number : - Position : 2118585 - 2118893 bp Length : 309 bp Strand : + Note : Product name confidence: class 4 (Homologs of previously reported genes of unknown function, or no similarity to any previously reported sequences) DNA sequence : ATGAGCAAGCAACGACGTACGTTTTCCGCCGAGTTCAAACGAGAGGCCGCGGCCCTGGTGTTGGACCAAGGCTACAGCTA TATCGACGCCTGCCGTTCGCTGGGGGGGGTGGATTCGGCCTTGCGCCGTTGGGTGAAGCAGCTCGAGGCGGAGCGCCAGG GTGTGACCCCGAAGAGCAAGGCGTTGACGCCTGAGCAGCAAAAGATCCAGGAGCTGGAAGCCCGGATCAACCGGTTGGAG CGGGAGAAAGCGATATTAAAAAAGGCTACCGCTCTCTTGATGTCGGACGAACTCGATCGTACGCGCTGA Protein sequence : MSKQRRTFSAEFKREAAALVLDQGYSYIDACRSLGGVDSALRRWVKQLEAERQGVTPKSKALTPEQQKIQELEARINRLE REKAILKKATALLMSDELDRTR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| RS05 | AAP82950.1 | putative transposase | Not tested | PAPI-2 | Protein | 2e-40 | 99 |
| l7045 | CAD33744.1 | - | Not tested | PAI I 536 | Protein | 5e-22 | 57 |
| orfA | CAE85179.1 | OrfA protein, IS911 | Not tested | PAI V 536 | Protein | 5e-22 | 57 |
| unnamed | CAD42034.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 2e-20 | 56 |
| insN | YP_002152325.1 | transposase for insertion sequence element IS911 | Not tested | Not named | Protein | 7e-21 | 55 |
| orfA | AGK06911.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 3e-21 | 55 |
| unnamed | AGK06948.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 3e-21 | 55 |
| orfA | AGK06994.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 3e-21 | 55 |
| orfA | AGK07052.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 3e-21 | 55 |
| VC1790 | NP_231425.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 5e-21 | 55 |
| orfA | ACX47959.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 3e-21 | 55 |
| orfA | YP_001217330.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 5e-21 | 55 |
| VPI2_0009c | ACA01826.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 3e-21 | 55 |
| api80 | CAF28554.1 | putative transposase | Not tested | YAPI | Protein | 3e-17 | 53 |
| aec66 | AAW51749.1 | Aec66 | Not tested | AGI-3 | Protein | 2e-22 | 51 |
| ECO111_3778 | YP_003236113.1 | putative IS602 transposase OrfA | Not tested | LEE | Protein | 3e-22 | 51 |
| unnamed | ACU09431.1 | IS911 transposase orfA | Not tested | LEE | Protein | 9e-21 | 50 |
| Z5088 | NP_290240.1 | hypothetical protein | Not tested | LEE | Protein | 9e-21 | 50 |
| ECs4535 | NP_312562.1 | hypothetical protein | Not tested | LEE | Protein | 9e-21 | 50 |
| unnamed | AAC31483.1 | L0004 | Not tested | LEE | Protein | 7e-21 | 50 |
| ORF SG13 | AAN62235.1 | conserved hypothetical protein | Not tested | PAGI-3(SG) | Protein | 4e-13 | 43 |
| unnamed | CAD42047.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 4e-10 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| PA1937 | NP_250627.1 | hypothetical protein | VFG1485 | Protein | 2e-22 | 57 |
| PA1937 | NP_250627.1 | hypothetical protein | VFG1553 | Protein | 8e-21 | 56 |
| PA1937 | NP_250627.1 | hypothetical protein | VFG1123 | Protein | 1e-21 | 55 |
| PA1937 | NP_250627.1 | hypothetical protein | VFG0784 | Protein | 3e-21 | 50 |
| PA1937 | NP_250627.1 | hypothetical protein | VFG1566 | Protein | 2e-10 | 41 |